Biochemicals and Reagents

<p>C20ORF116 antibody was raised using the middle region of C20Orf116 corresponding to a region with amino acids EERKRLESQREAEWKKEEERLRLEEEQKEEEERKAREEQAQREHEEYLKL</p>

<p>Rabbit polyclonal ACTA1 antibody (FITC)</p>

<p>CDC45L antibody was raised using a synthetic peptide corresponding to a region with amino acids VTVVGIPPETDSSDRKNFFGRAFEKAAESTSSRMLHNHFDLSVIELKAED</p>

<p>VZV protein is a key component in Life Sciences, specifically in the field of Proteins and Antigens. It plays a crucial role in various biological processes and has been extensively studied for its potential therapeutic applications. VZV protein has shown promising results in research involving ranolazine, where it was found to modulate the expression of messenger RNA (mRNA) associated with cardiac function. Additionally, VZV protein has been used for immobilization studies on electrodes, enabling ultrasensitive detection of dopamine and natriuretic peptides in human serum. Its neutralizing properties make it an ideal candidate for the development of monoclonal antibodies and DNA vaccines targeting specific pathogens. With its diverse range of applications, VZV protein continues to be at the forefront of cutting-edge research in the field of Life Sciences.</p>

<p>PHOSPHO2 antibody was raised in rabbit using the N terminal of PHOSPHO2 as the immunogen</p>

<p>5-Methyl cytosine antibody was raised in sheep using 5-methyl cytosine as the immunogen.</p>

<p>The UQCRC2 antibody is a potent antifibrotic agent that works by targeting and lysing specific cells involved in fibrosis. This monoclonal antibody has been extensively studied and validated using polymerase chain techniques, demonstrating its high specificity and efficacy. It has also been shown to effectively neutralize autoantibodies and inhibit the activation of mesenchymal stem cells, which play a crucial role in fibrotic processes. The UQCRC2 antibody specifically targets atypical hemolytic cells by binding to their surface receptors, leading to their destruction. Additionally, this antibody can be used for immunohistochemical detection of protein complexes, such as serine proteases or amyloid plaques, making it a valuable tool for research and diagnostic purposes. Available as both polyclonal and monoclonal antibodies, the UQCRC2 antibody offers a versatile solution for various applications in the field of immunology.</p>

<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the class of rifamycins. It is highly effective in treating tuberculosis infections and contains active compounds with bactericidal activity. The drug works by binding to DNA-dependent RNA polymerase, preventing transcription and replication, thus inhibiting bacterial growth. Extensive research has shown its high efficacy on human erythrocytes using a patch-clamp technique. The drug undergoes various metabolic transformations, including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Rifapentine also specifically targets markers expressed in Mycobacterium tuberculosis strains and inhibits their cell growth in culture.</p>

<p>Purified recombinant KLK1 protein (His tag)</p>

<p>Rabbit polyclonal SLC25A11 antibody</p>

<p>Mouse PMN antibody was raised in rabbit using murine PMNs as the immunogen.</p>

<p>PDE3A antibody was raised in rabbit using a synthetic peptide conjugated to KLH as the immunogen.</p>

<p>JUNB antibody was raised in mouse using recombinant Human Jun B Proto-Oncogene</p>

<p>Rabbit polyclonal TCTN1 antibody</p>

<p>Mouse monoclonal Rubeola virus antibody</p>

<p>LSM4 antibody was raised using a synthetic peptide corresponding to a region with amino acids GRGGLQQQKQQKGRGMGGAGRGVFGGRGRGGIPGTGRGQPEKKPGRQAGK</p>

<p>Chk1 antibody is a highly specific and sensitive antibody that can be used for various applications in the field of life sciences. This antibody specifically targets the Chk1 protein, which plays a crucial role in cell cycle regulation and DNA damage response. It has been extensively validated for its performance in techniques such as immunohistochemistry, Western blotting, and immunofluorescence.</p>

<p>Rabbit polyclonal KCNN4 antibody</p>

<p>Rabbit polyclonal SLC25A4 antibody</p>

<p>The FABP antibody is a monoclonal antibody that specifically targets fatty acid binding proteins (FABPs). FABPs are involved in the transportation and metabolism of fatty acids within cells. This antibody can be used for various applications, including research studies on the role of FABPs in cellular processes, as well as diagnostic tests for certain diseases.</p>

<p>Rabbit polyclonal PYGB antibody (FITC)</p>

<p>D-dimer antibody is a monoclonal antibody used in the field of Life Sciences for various applications. It has been extensively studied and proven to be effective in detecting D-dimer, a fibrin degradation product that is elevated in blood plasma during thrombotic events. This antibody can be used in electrochemical biosensing techniques, such as electrochemical impedance spectroscopy and chemiluminescence immunoassay, to accurately measure D-dimer levels. The D-dimer antibody is immobilized on a carbon electrode or colloidal gold surface, allowing for specific binding with D-dimer molecules present in the sample. Its high selectivity and sensitivity make it an ideal tool for diagnosing and monitoring thrombotic disorders. Additionally, this antibody has shown promising antioxidant activity, making it a potential candidate for further research in the field of lipid composition and estradiol level regulation.</p>

<p>HIV1 gp120 antibody was raised in rabbit using full length recombinant gp120 (HIV-1) as the immunogen.</p>

<p>Rabbit polyclonal TFAP2C antibody</p>

<p>Purified Rabbit polyclonal GPRIN3 antibody</p>

<p>The CD1a antibody is a crucial tool in the field of Life Sciences. It is a monoclonal antibody that specifically targets CD1a, a cell surface protein involved in various biological processes. This antibody can be used for research purposes to study the function and expression of CD1a in different cell types.</p>

<p>Sheep polyclonal Sulphatroxazole antibody</p>

<p>Purified recombinant LMX1B protein (His tag)</p>

<p>Rat monoclonal Rat anti-Mouse IgA antibody (FITC)</p>

<p>Mouse monoclonal NPR3 antibody</p>

<p>Rat monoclonal CIRE antibody (allophycocyanin)</p>

<p>Rabbit Polyclonal MRLC2 antibody (Ser18)</p>

<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the category of rifamycins. It is highly effective in treating tuberculosis infections, thanks to its bactericidal activity. By binding to DNA-dependent RNA polymerase, this drug inhibits bacterial growth by preventing transcription and replication. Its potency has been demonstrated through patch-clamp technique experiments on human erythrocytes. The active form of this drug undergoes various metabolic transformations, including hydrolysis, oxidation, reduction, and conjugation with glucuronic acid. Additionally, it specifically targets markers expressed in Mycobacterium tuberculosis strains and inhibits their cell growth in culture.</p>

<p>ERAL1 antibody was raised using a synthetic peptide corresponding to a region with amino acids KTAVWEEGPGGELVIQQKLLVPKESYVKLLIGPKGHVISQIAQEAGHDLM</p>

<p>Purified Rabbit polyclonal Smad3 antibody (Ser213)</p>

<p>The HIV1 Nef protein is a vital component in the field of Life Sciences. It is a serine protease inhibitor that plays a crucial role in neutralizing the effects of HIV1. This Recombinant Protein &amp; Antigen forms dimers and has been extensively studied for its potential therapeutic applications. Researchers have found that it exhibits inhibitory effects on the replication of HIV1, making it a promising target for drug development.</p>

<p>Sheep polyclonal Flunixin COOH antibody</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of C20ORF100 antibody, catalog no. 70R-7817</p>

<p>Recombinant Human KLF4 protein (His tag)</p>

<p>CYP4B1 antibody was raised using the N terminal of CYP4B1 corresponding to a region with amino acids SWAHQFPYAHPLWFGQFIGFLNIYEPDYAKAVYSRGDPKAPDVYDFFLQW</p>

<p>Armenian Hamster monoclonal CD69 antibody (PE)</p>

<p>LYVE1 antibody was raised in rabbit using recombinant human soluble Lyve-1 as the immunogen.</p>

<p>LDH antibody was raised in goat using full length lactate dehydrogenase protein isolated from rabbit muscle as the immunogen.</p>

<p>Rabbit polyclonal JAK2 antibody (Tyr931)</p>

<p>The STAT6 antibody is a protein-based antibody that specifically targets and binds to the STAT6 protein. This protein plays a crucial role in cellular signaling pathways and is involved in various biological processes such as immune response, cell growth, and differentiation. The STAT6 antibody can be used in various research applications, including Western blotting, immunohistochemistry, and immunofluorescence.</p>

<p>Mouse monoclonal NHEJ1 antibody</p>

<p>INTS12 antibody was raised in Rabbit using Human INTS12 as the immunogen</p>

<p>Mouse monoclonal ARHGAP25 antibody</p>

<p>S100 antibody was raised in mouse using human brain S-100 protein as the immunogen.</p>

<p>Tetracaine HCL (USP grade powder) chemical reference substance</p>

<p>Purified Polyclonal EGVEGF antibody</p>

<p>Purified recombinant FST protein (His tag)</p>

<p>ZBTB7C antibody was raised in rabbit using the N terminal of ZBTB7C as the immunogen</p>

<p>The MARCH5 antibody is a potent inhibitor that targets the MARCH5 protein. It belongs to the class of antibodies known as polyclonal antibodies, which are produced by multiple B cell clones and recognize different epitopes on the target antigen. The MARCH5 antibody specifically binds to a phosphorylation site on the MARCH5 protein, blocking its activity and preventing further phosphorylation events.</p>

<p>KEAP1 antibody was raised in rabbit using the C terminal of KEAP1 as the immunogen</p>

<p>C1orf57 antibody was raised in Rabbit using Human C1orf57 as the immunogen</p>

<p>Rabbit polyclonal p53 antibody (biotin)</p>

<p>ZDHHC24 antibody was raised using the N terminal of ZDHHC24 corresponding to a region with amino acids YVLVLGPGPPPLGPLARALQLALAAFQLLNLLGNVGLFLRSDPSIRGVML</p>

<p>The ZFP36 antibody is a powerful tool in the field of medicine. It is an autoantibody that specifically targets and binds to the ZFP36 protein, which plays a crucial role in nuclear regulation. This antibody can be used in various assays and experiments to study the function and localization of ZFP36.</p>

<p>Rabbit polyclonal CENTB1 antibody (Ser554)</p>

<p>PRMT3 antibody was raised in rabbit using the middle region of PRMT3 as the immunogen</p>

<p>Purified Rabbit polyclonal OR2J2 antibody</p>

<p>Mouse monoclonal TNNI3 antibody</p>

<p>HNRPH1 antibody was raised using the middle region of Hnrph1 corresponding to a region with amino acids FLNSTAGASGGAYEHRYVELFLNSTAGASGGAYGSQMMGGMGLSNQSSYG</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of KIAA0152 antibody, catalog no. 70R-8645</p>

<p>INTS3 antibody was raised in Rabbit using Human INTS3 as the immunogen</p>

<p>WDHD1 antibody was raised in rabbit using the C terminal of WDHD1 as the immunogen</p>

<p>CCDC28A antibody was raised in Rabbit using Human CCDC28A as the immunogen</p>

<p>TPTE antibody was raised using the middle region of TPTE corresponding to a region with amino acids IQIEMEKKVVFSTISLGKCSVLDNITTDKILIDVFDGLPLYDDVKVQFFY</p>

<p>Rabbit polyclonal SYTL4 antibody</p>

<p>Mouse monoclonal ERCC4 antibody</p>

<p>The SATB1 antibody is a high-flux monoclonal antibody that has antiviral properties. It is commonly used in assays to detect the presence of interleukins and other antigens. This antibody is also used in the development of polyclonal antibodies, which are important tools in biomedical research. In addition, the SATB1 antibody can be used as a serum marker for various diseases and conditions. Its affinity for binding to specific targets makes it an essential component in many life sciences applications. Whether you're conducting experiments or developing new medicaments, this SATB1 antibody will provide reliable and accurate results.</p>

<p>Purified Rabbit polyclonal PGRMC2 antibody</p>

<p>MRGPRX2 antibody was raised in rabbit using the middle region of MRGPRX2 as the immunogen</p>

<p>The Cytokeratin 18 antibody is a diagnostic reagent that specifically targets the protein complex known as cytokeratin 18. This antibody is designed to detect and bind to cytokeratin 18, which is a type of intermediate filament protein found in epithelial cells. The antibody can be used for various applications, including immunohistochemistry and Western blotting, to study the expression and localization of cytokeratin 18 in different tissues and cell types. It is available as both polyclonal antibodies and monoclonal antibodies, providing researchers with options for their specific experimental needs. With its high specificity and sensitivity, the Cytokeratin 18 antibody is an essential tool for studying epithelial cell biology and diagnosing certain diseases related to cytokeratin 18 expression.</p>

<p>Rabbit polyclonal RPP40 antibody</p>

<p>ZP4 antibody was raised using the N terminal of ZP4 corresponding to a region with amino acids MWLLRCVLLCVSLSLAVSGQHKPEAPDYSSVLHCGPWSFQFAVNLNQEAT</p>

<p>Rabbit polyclonal RPS6KA2 antibody</p>

<p>Purified Polyclonal CD158b1 antibody</p>

<p>Purified Polyclonal HLA DOB antibody</p>

<p>Rabbit polyclonal DNAPK antibody (Thr2647)</p>

<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug belonging to the rifamycins class. It is highly effective in treating tuberculosis infections due to its strong bactericidal activity. This compound works by binding to DNA-dependent RNA polymerase, preventing transcription and replication, thus inhibiting bacterial growth. Studies have shown that it has a high affinity for human erythrocytes, as demonstrated using the patch-clamp technique. Metabolically, it undergoes various transformations such as hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, 6-Fluoro-3-indoxyl-beta-D-galactopyranoside specifically targets markers expressed at high levels in Mycobacterium tuberculosis strains and inhibits their growth in culture.</p>

<p>The Calreticulin antibody is a polyclonal antibody that specifically targets the protein calreticulin. It plays a crucial role in various cellular processes, including calcium homeostasis, protein folding, and quality control. The antibody recognizes calreticulin in different tissues and cell types, such as adipose tissue and adipocytes.</p>

<p>FBP2 antibody was raised using the middle region of FBP2 corresponding to a region with amino acids YAKYFDAATTEYVQKKKFPEDGSAPYGARYVGSMVADVHRTLVYGGIFLY</p>

<p>Purified Rabbit polyclonal DYNLL2 antibody</p>

<p>Purified recombinant PSMD13 protein (His tag)</p>

<p>The EGR1 antibody is a polyclonal antibody that is widely used in Life Sciences research. It specifically targets the early growth response protein 1 (EGR1), which plays a crucial role in various cellular processes such as growth, differentiation, and apoptosis. This antibody has been extensively validated for its specificity and sensitivity in detecting EGR1 expression in different tissues and cell types.</p>

<p>Rabbit polyclonal CK1 gamma 1/2/3 antibody (Tyr263)</p>

<p>Rabbit polyclonal TMEM67 antibody</p>

<p>MRPL46 antibody was raised in Rabbit using Human MRPL46 as the immunogen</p>

<p>IRAK3 antibody was raised using the C terminal of IRAK3 corresponding to a region with amino acids NTLESTQASLYFAEDPPTSLKSFRCPSPLFLENVPSIPVEDDESQNNNLL</p>

<p>30-207 amino acids: MGSSHHHHHH SSGLVPRGSH CSKGSGDPSS SSSSGNPLVY LDVDANGKPL GRVVLELKAD VVPKTAENFR ALCTGEKGFG YKGSTFHRVI PSFMCQAGDF TNHNGTGGKS IYGSRFPDEN FTLKHVGPGV LSMANAGPNT NGSQFFICTI KTDWLDGKHV VFGHVKEGMD VVKKIESFGS KSGRTSKKIV ITDCGQLS</p>

<p>LMAN2 antibody was raised using the C terminal of LMAN2 corresponding to a region with amino acids LMVEHTPDEESIDWTKIEPSVNFLKSPKDNVDDPTGNFRSGPLTGWRVFL</p>

<p>Mouse monoclonal PASK antibody</p>

<p>The RhoH antibody is a therapeutically valuable hematopoietic agent. It belongs to the class of polyclonal antibodies that have the ability to inhibit cytokines. This antibody is widely used in life sciences research as a valuable protein reagent. Its high quality and effectiveness make it an essential tool for studying various biological processes and developing new therapeutic strategies. With its ability to target specific proteins, the RhoH antibody offers great potential for advancing our understanding of complex diseases and improving patient outcomes.</p>

<p>The Methamphetamine antibody is a reactive antibody that is used in Life Sciences for various applications. It specifically targets methamphetamine, a potent stimulant drug. This antibody can be used in research and diagnostic settings to detect the presence of methamphetamine in human serum samples. It has high affinity and specificity for methamphetamine, making it an ideal tool for detecting and quantifying this drug. The Methamphetamine antibody is also capable of neutralizing the effects of methamphetamine by binding to it and preventing its interaction with cellular targets. This antibody can be conjugated with streptavidin or other molecules to facilitate detection or purification processes. Overall, the Methamphetamine antibody is a valuable tool for studying the effects of methamphetamine and developing peptide agents or therapeutic strategies to counteract its harmful effects.</p>

<p>Rabbit polyclonal GPR113 antibody</p>

<p>Rabbit polyclonal TCEB2 antibody</p>

<p>The ME2 antibody is a polyclonal antibody commonly used in Life Sciences research. It is specifically designed to target and detect amyloid plaque, which plays a crucial role in various neurodegenerative diseases. This antibody has been extensively tested and validated for its specificity and sensitivity.</p>

<p>Rat monoclonal CD11b antibody (biotin)</p>