Biochemicals and Reagents
Biochemicals and reagents are fundamental substances for research and development in fields such as biotechnology, molecular biology, pharmacology, and medicine. These products are essential for a variety of applications, including compound synthesis, biological sample analysis, metabolic process research, and drug production. At CymitQuimica, we offer a wide selection of high-quality, high-purity biochemicals and reagents suitable for various scientific and industrial needs. Our catalog includes enzymes, antibodies, nucleic acids, amino acids, and many other products, all designed to support researchers and professionals in their research and development projects, ensuring reliable and reproducible results.
Subcategories of "Biochemicals and Reagents"
- Biomolecules(98,575 products)
- By Biological Target(100,710 products)
- By Pharmacological Effects(6,937 products)
- Cryopreservatives(21 products)
- Desinfectants and Related Compounds(28 products)
- Hormones(421 products)
- Plant Biology(6,907 products)
- Secondary Metabolites(14,367 products)
Found 130493 products of "Biochemicals and Reagents"
Sort by
Purity (%)
0
100
|
0
|
50
|
90
|
95
|
100
CCNDBP1 antibody
CCNDBP1 antibody was raised in rabbit using the middle region of CCNDBP1 as the immunogenPurity:Min. 95%Aadacl1 antibody
Aadacl1 antibody was raised in rabbit using the middle region of Aadacl1 as the immunogenPurity:Min. 95%HER2 antibody
The HER2 antibody is a highly specialized antibody used in the field of Life Sciences. It can be either a polyclonal or monoclonal antibody, designed to target the HER2 protein molecule. This protein is found on the surface of certain cancer cells and is associated with aggressive tumor growth.Purity:Min. 95%ACOT12 antibody
ACOT12 antibody was raised using the middle region of ACOT12 corresponding to a region with amino acids SASRLCWAHPFLKSVDMFKFRGPSTVGDRLVFTAIVNNTFQTCVEVGVRVCD11a antibody (Azide Free)
CD11a antibody was raised in mouse using human CD11a (LFA-1a) as the immunogen.CD42c antibody
The CD42c antibody is a potent inhibitor that targets the platelet membrane. It acts as a metastasis inhibitor by preventing the attachment of cancer cells to platelets, thereby inhibiting their spread to other parts of the body. The CD42c antibody can be used in various applications, including in vitro experiments and life sciences research. It is commonly used in immunosorbent assays and can also be conjugated to liposomes or protein microparticles for targeted drug delivery. This polyclonal antibody specifically recognizes and binds to activated CD42c glycoprotein on platelets, providing a reliable tool for studying platelet function and related disorders. With its high specificity and efficacy, the CD42c antibody is an essential component for researchers and scientists working in the field of platelet biology and metastasis inhibition.
Tmem33 antibody
Tmem33 antibody was raised in rabbit using the middle region of Tmem33 as the immunogenPurity:Min. 95%SARS antibody
SARS antibody was raised using the middle region of SARS corresponding to a region with amino acids SQFDEELYKVIGKGSEKSDDNSYDEKYLIATSEQPIAALHRDEWLRPEDLVEGFB antibody
The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the class of rifamycins. It is highly effective in treating tuberculosis infections due to its potent bactericidal activity. This drug works by binding to DNA-dependent RNA polymerase, preventing transcription and replication, thereby inhibiting bacterial growth. Extensive studies have demonstrated its efficacy using advanced techniques like transcription-quantitative polymerase chain and patch-clamp technique. The active form of this drug undergoes various metabolic transformations, including hydrolysis by esterases or glucuronidases, oxidation by cytochrome p450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, it specifically targets Mycobacterium tuberculosis strains and inhibits their cell growth in culture.FLYWCH1 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of FLYWCH1 antibody, catalog no. 70R-10075
Purity:Min. 95%H1FOO Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of H1FOO antibody, catalog no. 70R-2024Purity:Min. 95%GBA3 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of GBA3 antibody, catalog no. 70R-9508Purity:Min. 95%MAT1A antibody
MAT1A antibody was raised using the C terminal of MAT1A corresponding to a region with amino acids VAKSLVKAGLCRRVLVQVSYAIGVAEPLSISIFTYGTSQKTERELLDVVHApoBEC2 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of APOBEC2 antibody, catalog no. 70R-1425Purity:Min. 95%BCHE antibody
BCHE antibody was raised using the N terminal of BCHE corresponding to a region with amino acids SSLHVYDGKFLARVERVIVVSMNYRVGALGFLALPGNPEAPGNMGLFDQQTau antibody
The Tau antibody is a highly specialized Polyclonal Antibody that targets the annexin protein. It is commonly used in Life Sciences research for its ability to inhibit the activity of oncostatin and anti-cd33 antibodies. This monoclonal antibody offers a powerful tool for researchers studying the role of annexin in various cellular processes.p53 antibody
The p53 antibody is a highly sought-after product in the field of Life Sciences. It is an antibody that specifically targets and binds to the p53 protein, which plays a crucial role in regulating cell growth and preventing tumor formation. This monoclonal antibody has been extensively tested and validated for its specificity and sensitivity in detecting p53 protein expression in human serum samples.Purity:Min. 95%SRA1 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of SRA1 antibody, catalog no. 70R-10353Purity:Min. 95%cFLIP antibody
The cFLIP antibody is a highly specialized monoclonal antibody that has been developed for use in the field of Life Sciences. It is designed to target and neutralize the activity of cFLIP, a glycoprotein that plays a crucial role in various cellular processes. This antibody has been extensively tested and proven to be effective in blocking the activity of cFLIP, making it an invaluable tool for researchers studying this protein.
Tau antibody
The Tau antibody is a highly specialized monoclonal antibody that targets and binds to tau proteins in the brain. Tau proteins play a crucial role in stabilizing microtubules, which are responsible for maintaining the structure and function of neurons. However, in neurodegenerative diseases such as Alzheimer's, tau proteins become abnormally phosphorylated and form tangles, leading to neuronal dysfunction and cognitive decline.Purity:Min. 95%SSBP3 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of SSBP3 antibody, catalog no. 70R-3546Purity:Min. 95%TGF β 1 antibody
TGF beta 1 antibody was raised in Mouse using a purified recombinant fragment of TGFbeta1 expressed in E. coli as the immunogen.CBR4 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of CBR4 antibody, catalog no. 70R-10143
Purity:Min. 95%Goat anti Human IgG (H + L)
This antibody reacts with heavy chains on human IgG (gamma chain) and light chains on all human immunoglobulins.Purity:Min. 95%SLC17A2 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of SLC17A2 antibody, catalog no. 70R-7000Purity:Min. 95%CLPB antibody
CLPB antibody was raised using a synthetic peptide corresponding to a region with amino acids QGGRFDTKCLAAATWGRLPGPEETLPGQDSWNGVPSRAGLGMCALAAALVGalectin 3 antibody
Galectin 3 antibody is an essential tool used in Life Sciences research. It is a polyclonal antibody that specifically targets galectin 3, a protein involved in various biological processes. This antibody has been extensively studied and proven to be effective in neutralizing the activity of galectin 3.PRMT1 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of PRMT1 antibody, catalog no. 70R-1243Purity:Min. 95%GGTL3 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of GGTL3 antibody, catalog no. 70R-6413Purity:Min. 95%GALE antibody
GALE antibody was raised in rabbit using the middle region of GALE as the immunogenPurity:Min. 95%ASPH Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of ASPH antibody, catalog no. 70R-1844Purity:Min. 95%ZNF284 antibody
ZNF284 antibody was raised in rabbit using the middle region of ZNF284 as the immunogenPurity:Min. 95%NONO antibody
NONO antibody was raised using the N terminal of NONO corresponding to a region with amino acids KQNHTPRKHHQHHHQQQHHQQQQQQPPPPPIPANGQQASSQNEGLTIDLK
CEACAM6 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of CEACAM6 antibody, catalog no. 70R-1221Purity:Min. 95%Keratin K6 antibody
Keratin K6 antibody was raised in Guinea Pig using synthetic peptide of human keratin K6 coupled to KLH as the immunogen.Purity:Min. 95%ZNF578 antibody
ZNF578 antibody was raised in rabbit using the N terminal of ZNF578 as the immunogenPurity:Min. 95%PI3K antibody
The PI3K antibody is a powerful tool in the field of Life Sciences. It is used to study the role of phosphoinositide 3-kinase (PI3K) in various cellular processes, including cell growth, proliferation, and survival. This antibody specifically targets and binds to the activated form of PI3K, allowing researchers to analyze its function and activity.Purity:Min. 95%FMO3 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of FMO3 antibody, catalog no. 70R-6582Purity:Min. 95%IPKA antibody
The IPKA antibody is a histidine-rich growth factor that is capable of neutralizing autoantibodies. It belongs to the class of monoclonal antibodies and has shown promising results in various studies. The IPKA antibody has been extensively studied in the field of Life Sciences and has been found to have natriuretic and neuroprotective properties. It works by specifically targeting and binding to specific antigens, leading to an antigen-antibody reaction that helps in the activation of certain biological processes. With its unique properties, the IPKA antibody holds great potential for therapeutic applications in various fields.ZNF624 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of ZNF624 antibody, catalog no. 70R-7960
Purity:Min. 95%AGPAT3 antibody
AGPAT3 antibody was raised in rabbit using the middle region of AGPAT3 as the immunogen
IL1b antibody
The IL1b antibody is a specific antibody that is commonly used in the field of Life Sciences. This antibody is designed to specifically bind to IL1b, which is a protein involved in immune response and inflammation. The IL1b antibody can be used for various applications, including immobilization on an electrode for detection purposes. It recognizes tyrosine residues on IL1b and can be used to study the activation of this protein. Additionally, the IL1b antibody can be used in research related to cancer treatment, as it has been shown to have antagonist binding properties against oncogenic kinases such as epidermal growth factor receptor (EGFR). Overall, the IL1b antibody is a valuable tool for researchers studying immune response, inflammation, and cancer biology.
Beta-2-microglobulin monoclonal antibody
The Beta-2-microglobulin monoclonal antibody is a powerful tool in the field of Life Sciences. This monoclonal antibody specifically targets and binds to Beta-2-microglobulin, a protein found on the surface of cells. By binding to this protein, the antibody can modulate various cellular processes.Rab1A antibody
The Rab1A antibody is a highly effective growth factor that is used in the field of Life Sciences. This biochemical compound is available in both monoclonal and polyclonal forms, making it versatile for various applications. The Rab1A antibody works by inhibiting the activity of Rab1A, a protein involved in intracellular trafficking. By blocking this protein, the antibody prevents the transport of molecules within cells, thereby affecting cellular processes such as nuclear signaling and e-cadherin expression. With its high specificity and affinity, this antibody is an essential tool for researchers studying cellular mechanisms and developing new medicaments. Whether you're working on a colloidal microsphere or exploring inhibitors for specific pathways, the Rab1A antibody is an indispensable asset in your scientific arsenal. Trust its exceptional performance to deliver accurate results and advance your research in the field of Life Sciences.IL1R alpha protein
Region of IL1R alpha protein corresponding to amino acids MRPSGRKSSK MQAFRIWDVN QKTFYLRNNQ LVAGYLQGPN VNLEEKIDVV PIEPHALFLG IHGGKMCLSC VKSGDETRLQ LEAVNITDLS ENRKQDKRFA FIRSDSGPTT SFESAACPGW FLCTAMEADQ PVSLTNMPDE GVMVTKFYFQ EDE.Purity:Min. 95%LOC642486 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of LOC642486 antibody, catalog no. 70R-1977Purity:Min. 95%CACYBP antibody
CACYBP antibody was raised using the middle region of CACYBP corresponding to a region with amino acids FTERSFDLLVKNLNGKSYSMIVNNLLKPISVEGSSKKVKTDTVLILCRKKGoat anti Human IgG (H + L) (rhodamine)
Goat anti-human IgG (H+L) (Rhodamine) was raised in goat using human IgG whole molecule as the immunogen.SLC7A14 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of SLC7A14 antibody, catalog no. 70R-1797Purity:Min. 95%PKMYT1 antibody
The PKMYT1 antibody is a mouse monoclonal antibody that is used as a diagnostic agent in the field of Life Sciences. It specifically targets and binds to PKMYT1, a cytosolic protein involved in cell cycle regulation. This antibody can be used for various applications such as immunohistochemistry, Western blotting, and flow cytometry. Its high specificity and affinity make it an ideal tool for studying the expression and localization of PKMYT1 in different tissues and cell types. Additionally, this antibody has been shown to have genotoxic effects on pluripotent stem cells, making it a valuable tool for research in regenerative medicine. With its ability to detect activated PKMYT1 and its potential use in diagnosing diseases associated with abnormal cell cycle regulation, this antibody holds great promise in advancing our understanding of various biological processes.CDC25C antibody
The CDC25C antibody is a powerful tool used in Life Sciences research. It is an enzyme substrate that can be used for chromatographic analysis of reactive oxygen species (ROS) and binding proteins. This antibody specifically targets CDC25C, a protein kinase involved in cell cycle regulation. By targeting and inhibiting CDC25C, this antibody can effectively disrupt the cell cycle and inhibit cell division.Purity:Min. 95%BCL2 antibody
The BCL2 antibody is a highly specialized product in the field of Life Sciences. This antibody is designed to target and bind to the B-cell lymphoma 2 (BCL2) protein, which plays a crucial role in regulating cell death and survival. The BCL2 antibody can be used in various research applications, including immunohistochemistry, western blotting, and flow cytometry.
WBP4 antibody
WBP4 antibody was raised in rabbit using the N terminal of WBP4 as the immunogenPurity:Min. 95%Ezrin antibody
The Ezrin antibody is a powerful tool in the field of life sciences. It is a neutralizing antibody that specifically targets β-catenin, an important protein involved in cell adhesion and signaling pathways. This polyclonal antibody can be used in various research applications, including immunohistochemistry, western blotting, and flow cytometry.Purity:Min. 95%TAGLN 3 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of TAGLN 3 antibody, catalog no. 70R-9267
Purity:Min. 95%Transglutaminase 3 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of TGM3 antibody, catalog no. 70R-3925
Purity:Min. 95%UBE2N Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of UBE2N antibody, catalog no. 70R-1157Purity:Min. 95%POGZ Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of POGZ antibody, catalog no. 70R-8313Purity:Min. 95%Src antibody
The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the class of rifamycins. It is specifically designed to combat tuberculosis infection by targeting the active compounds responsible for bactericidal activity. This drug works by binding to DNA-dependent RNA polymerase, preventing transcription and replication, thus inhibiting bacterial growth. Its effectiveness has been demonstrated through extensive research using the patch-clamp technique on human erythrocytes. Additionally, this drug undergoes various metabolic transformations, including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Moreover, it exhibits high affinity for markers expressed in Mycobacterium tuberculosis strains and effectively inhibits cell growth in culture.Abo antibody
Abo antibody was raised in rabbit using the middle region of Abo as the immunogenPurity:Min. 95%HCN3 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of HCN3 antibody, catalog no. 70R-5168Purity:Min. 95%Ascc1 antibody
Ascc1 antibody was raised in rabbit using the C terminal of Ascc1 as the immunogen
Purity:Min. 95%
