Biochemicals and Reagents

<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug belonging to the class of rifamycins. It is highly effective in treating tuberculosis infections. This active compound exhibits bactericidal activity by binding to DNA-dependent RNA polymerase, preventing transcription and replication. Through various metabolic transformations, including hydrolysis, oxidation, reduction, and conjugation, it is metabolized in the body. Rifapentine specifically targets markers expressed by Mycobacterium tuberculosis strains and inhibits their growth. With its proven efficacy and multiple mechanisms of action, this drug offers a promising solution for combating tuberculosis.</p>

<p>This antibody reacts with heavy chains on Goat IgG and light chains on all Goat immunoglobulins.</p>

<p>TMEM16A antibody was raised using the middle region of TMEM16A corresponding to a region with amino acids HGFVNHTLSSFNVSDFQNGTAPNDPLDLGYEVQICRYKDYREPPWSENKY</p>

<p>The HDAC3 antibody is a highly specialized monoclonal antibody that acts as a neutralizing agent against the activity of histone deacetylase 3 (HDAC3). It plays a crucial role in regulating gene expression by modifying chromatin structure. The HDAC3 antibody specifically targets and inhibits the enzymatic activity of HDAC3, preventing it from removing acetyl groups from histone proteins. This inhibition leads to increased histone acetylation, resulting in altered gene expression patterns.</p>

<p>Purified Polyclonal OTF3 antibody</p>

<p>The NT5C1A antibody is a polyclonal antibody used in life sciences research. It is specifically designed to target and bind to the NT5C1A protein, which plays a crucial role in various cellular processes. This antibody can be used in experiments involving anti-HER2 antibody, monoclonal antibodies, growth factors, and reaction solutions. Furthermore, it has been shown to have antiangiogenic properties and can inhibit the activity of vascular endothelial growth factor (VEGF), a key regulator of angiogenesis. Additionally, the NT5C1A antibody has been found to be effective in blocking the activation of cardiomyocytes and autoantibodies involved in certain diseases. With its high specificity and reliability, this antibody is an invaluable tool for researchers studying cellular signaling pathways and developing therapeutic interventions.</p>

<p>Mouse monoclonal KCNAB1 antibody</p>

<p>Purified Polyclonal NF kappaB p105 antibody</p>

<p>Rabbit Polyclonal ELOVL5 antibody</p>

<p>Mouse monoclonal SulT1A1 antibody</p>

<p>The TRIM24 antibody is a highly specialized monoclonal antibody used in Life Sciences research. It specifically targets the growth hormone receptor and has been shown to inhibit the activity of this receptor. The TRIM24 antibody is commonly used in studies investigating the role of growth factors, such as trastuzumab, and their interaction with receptors. Additionally, it has been used to study the function of phosphatases and their involvement in cellular signaling pathways. This antibody can be used in various applications, including Western blotting, immunohistochemistry, and flow cytometry. With its high specificity and sensitivity, the TRIM24 antibody is an invaluable tool for researchers studying cell growth and signaling processes.</p>

<p>Rabbit polyclonal MAP2K7 antibody</p>

<p>SIGLEC6 antibody was raised using the N terminal of SIGLEC6 corresponding to a region with amino acids MQGAQEASASEMLPLLLPLLWAGALAQERRFQLEGPESLTVQEGLCVLVP</p>

<p>OR2AT4 antibody was raised using the N terminal of OR2AT4 corresponding to a region with amino acids MDATACNESVDGSPVFYLLGIPSLPETFFLPVFFIFLLFYLLILMGNALI</p>

<p>Mouse monoclonal LIPG antibody</p>

<p>The PRDX3 antibody is a highly specialized product in the field of Life Sciences. It is widely used in various chromatographic techniques and bioassays. This antibody specifically targets nuclear β-catenin, a protein that plays a crucial role in cell signaling and gene expression. The PRDX3 antibody is commonly employed in immunoassays to detect and quantify the levels of β-catenin in biological samples.</p>

<p>IFIH1 antibody was raised in Rabbit using Human IFIH1 as the immunogen</p>

<p>HAAO antibody was raised in Rabbit using Human HAAO as the immunogen</p>

<p>The DCC antibody is a powerful tool for researchers studying kinase signaling pathways. It specifically targets the kinase kinase of the mitogen-activated protein (MAP) kinase pathway, making it an essential component in understanding cellular responses to growth factors and other stimuli. The DCC antibody is available as both monoclonal and polyclonal antibodies, allowing researchers to choose the best option for their specific experiments.</p>

<p>Rabbit polyclonal TPH2 antibody (Ser58)</p>

<p>Rabbit polyclonal VEGFC antibody (FITC)</p>

<p>LAPTM4B antibody was raised using the middle region of LAPTM4B corresponding to a region with amino acids YPNSIQEYIRQLPPNFPYRDDVMSVNPTCLVLIILLFISIILTFKGYLIS</p>

<p>Mouse monoclonal RIT2 antibody</p>

<p>The STAG2 antibody is a polypeptide used in Life Sciences research. It is a polyclonal antibody that specifically targets the STAG2 antigen. This antibody is commonly used in studies involving nucleic acids and can be used to detect and analyze various nucleic acid molecules. Its high specificity and sensitivity make it an essential tool for researchers working in the field of molecular biology and genetics. With its wide range of applications, the STAG2 antibody is a valuable asset for any laboratory or research facility.</p>

<p>The SYN1 antibody is a highly specialized product used in the field of Life Sciences. It is a polyclonal antibody that specifically targets the SYN1 antigen. This antibody has been extensively tested and proven to be effective in various applications such as immunohistochemistry, western blotting, and enzyme-linked immunosorbent assay (ELISA).</p>

<p>Mouse monoclonal Complement H antibody (Biotin)</p>

<p>Purified Polyclonal USP35 antibody</p>

<p>Apramycin Conjugate for use in immunoassays</p>

<p>Rabbit polyclonal BCLW antibody</p>

<p>Junctophilin 2 antibody was raised using the middle region of JPH2 corresponding to a region with amino acids ANQESNIARTLARELAPDFYQPGPEYQKRRLLQEILENSESLLEPPDRGA</p>

<p>Carbonic Anhydrase IV antibody was raised using the middle region of CA4 corresponding to a region with amino acids DGEHFAMEMHIVHEKEKGTSRNVKEAQDPEDEIAVLAFLVEAGTQVNEGF</p>

<p>Mouse monoclonal p53 antibody (Prediluted for IHC)</p>

<p>Collagen Type IV alpha 3 antibody was raised using a synthetic peptide corresponding to a region with amino acids PPVERCGVLSKWTNYIHGWQDRWVVLKNNALSYYKSEDETEYGCRGSICL</p>

<p>Mouse monoclonal FOLH1 antibody</p>

<p>Rabbit polyclonal STRADB antibody</p>

<p>TECK antibody was raised in mouse using highly pure recombinant human TECK as the immunogen.</p>

<p>The BECN1 antibody is a monoclonal antibody that specifically targets the epidermal growth factor-like domain of BECN1. It has been shown to neutralize the activity of TNF-α, a pro-inflammatory cytokine involved in various diseases. This specific antibody can inhibit the binding of TNF-α to its receptor and prevent downstream signaling pathways associated with inflammation. In addition, the BECN1 antibody has been found to block the interaction between growth factors and fibronectin, inhibiting cell migration and proliferation. It also shows potential in modulating chemokine expression and regulating TGF-beta signaling. With its wide range of applications in life sciences, this antibody holds promise for research and therapeutic purposes in collagen-related diseases and other inflammatory conditions.</p>

<p>CXCR4 antibody was raised in goat using YSEEVGSGDYDSNKEPCFRDENVHFNR corresponding to the N-terminal extracellular domain of mouse CXCR4 receptor.   as the immunogen.</p>

<p>This antibody reacts with heavy (gamma) chains on rabbit IgG and light chains on all rabbit immunoglobulins.</p>

<p>Human IgG Fc antibody was raised in goat using human IgG, Fc fragment as the immunogen.</p>

<p>Mouse monoclonal TFAP2C antibody</p>

<p>MUC1 antibody was raised using the middle region of MUC1 corresponding to a region with amino acids GCAGHCLSHCLGCLSVPPKELRAAGHLSSPGYLPSYERVPHLPHPWALCA</p>

<p>Mouse monoclonal CTDSP1 antibody</p>

<p>Mouse monoclonal SLC2A5 antibody</p>

<p>Sheep polyclonal Ketoprofen antibody</p>

<p>Mouse monoclonal RPN10 antibody</p>

<p>GPD1 antibody was raised in Rabbit using Human GPD1 as the immunogen</p>

<p>Sheep polyclonal 17b Nortestosterone antibody</p>

<p>4-[(6-Chloro-2-methoxy-9-acridinyl)amino]-2-[(4-methyl-1-piperazinyl)methyl]phenol trihydrochloride is an inhibitor of receptor, ligand, and activator. It is a high purity product that is used in life science, pharmacology, and cell biology research. It is also used as a research tool for studying ion channels and peptides. This compound can be used to study protein interactions with antibodies and other proteins.</p>

<p>Purified Polyclonal GYS1 antibody</p>

<p>Rabbit Polyclonal TMEM200A antibody</p>

<p>Purified Rabbit polyclonal OR13G1 antibody</p>

<p>INSIG1 antibody was raised using the middle region of INSIG1 corresponding to a region with amino acids ITIAFLATLITQFLVYNGVYQYTSPDFLYIRSWLPCIFFSGGVTVGNIGR</p>

<p>Keratin K20 antibody was raised in mouse using electrophoretically purified keratin K20 from human intestinal mucosa as the immunogen.</p>

<p>Rabbit polyclonal OR6S1 antibody</p>

<p>Mouse monoclonal ANKRD53 antibody</p>

<p>Rabbit polyclonal ABL1 antibody (Tyr204)</p>

<p>Rabbit polyclonal COX41 antibody</p>

<p>1-646 amino acids: MGSSHHHHHH SSGLVPRGSH MSKGPAVGID LGTTYSCVGV FQHGKVEIIA NDQGNRTTPS YVAFTDTERL IGDAAKNQVA MNPTNTVFDA KRLIGRRFDD AVVQSDMKHW PFMVVNDAGR PKVQVEYKGE TKSFYPEEVS SMVLTKMKEI AEAYLGKTVT NAVVTVPAYF NDSQRQATKD AGTIAGLNVL RIINEPTAAA IAYGLDKKVG AERNVLIFDL GGGTFDVSIL TIEDGIFEVK STAGDTHLGG EDFDNRMVNH FIAEFKRKHK KDISENKRAV RRLRTACERA KRTLSSSTQA SIEIDSLYEG IDFYTSITRA RFEELNADLF RGTLDPVEKA LRDAKLDKSQ IHDIVLVGGS TRIPKIQKLL QDFFNGKELN KSINPDEAVA YGAAVQAAIL SGDKSENVQD LLLLDVTPLS LGIETAGGVM TVLIKRNTTI PTKQTQTFTT YSDNQPGVLI QVYEGERAMT KDNNLLGKFE LTGIPPAPRG VPQIEVTFDI DANGILNVSA VDKSTGKENK ITITNDKGRL SKEDIERMVQ EAEKYKAEDE KQRDKVSSKN SLESYAFNMK ATVEDEKLQG KINDEDKQKI LDKCNEIINW LDKNQTAEKE EFEHQQKELE KVCNPIITKL YQSAGGMPGG MPGGFPGGGA PPSGGASSGP TIEEVD</p>

<p>Adiponectin antibody was raised in mouse using recombinant human adiponectin (15-244aa) purified from E. coli as the immunogen.</p>

<p>Ccna2 antibody was raised in rabbit using the C terminal of Ccna2 as the immunogen</p>

<p>MFSD1 antibody was raised using the middle region of MFSD1 corresponding to a region with amino acids  RFVFGIGGESLAVAQNTYAVSWFKGKELNLVFGLQLSMARIGSTVNMNLM</p>

<p>ANXA3 antibody is a monoclonal antibody that targets mesothelin, a growth factor that is overexpressed in various types of cancer. This antibody specifically binds to mesothelin and neutralizes its activity, inhibiting tumor growth and metastasis. ANXA3 antibody has been shown to have high specificity and affinity for mesothelin, making it an effective tool for diagnostic assays and potential therapeutic applications. Additionally, this antibody can be used in research studies to investigate the role of mesothelin in cancer development and progression. Overall, ANXA3 antibody offers promise as a valuable tool in the fight against cancer.</p>

<p>Mouse monoclonal Cytokeratin 13 antibody</p>

<p>IQWD1 antibody was raised in Rabbit using Human IQWD1 as the immunogen</p>

<p>BCKDK antibody was raised using the N terminal of BCKDK corresponding to a region with amino acids CLPFIIGCNPTILHVHELYIRAFQKLTDFPPIKDQADEAQYCQLVRQLLD</p>

<p>EIF4G3 antibody was raised using the middle region of EIF4G3 corresponding to a region with amino acids MRGGSSKDLLDNQSQEEQRREMLETVKQLTGGVDVERNSTEAERNKTRES</p>

<p>Rabbit polyclonal PSMC6 antibody</p>

<p>Mouse monoclonal ITFG2 antibody</p>

<p>The Giardia lamblia antibody is a monoclonal antibody that has been developed for use in the field of Life Sciences. It is specifically designed to target and bind to Giardia lamblia, a common parasite that causes gastrointestinal infections in humans. This antibody works by recognizing and binding to specific proteins on the surface of Giardia lamblia, effectively neutralizing its activity and preventing further infection.</p>

<p>Purified recombinant TRAPPC2 protein</p>

<p>Rabbit polyclonal TSR2 antibody</p>

<p>FBXL4 antibody was raised in mouse using recombinant Human F-Box And Leucine-Rich Repeat Protein 4 (Fbxl4)</p>

<p>Rabbit polyclonal SMAP1 antibody</p>

<p>Rabbit polyclonal RPS27L antibody</p>

<p>N-[2-(3,4-Dichloroanilino)quinolin-4-yl]cyclohexanecarboxamide is a peptide that acts as an activator of ion channels and a ligand for receptors. It also has the ability to inhibit protein interactions. N-[2-(3,4-Dichloroanilino)quinolin-4-yl]cyclohexanecarboxamide is a research tool for cell biology and pharmacology studies. This peptide is used in the study of ion channels and their role in cell signaling. It can be used to study receptor binding or protein interactions with ligands.</p>

<p>GRAMD2 antibody was raised using the middle region of GRAMD2 corresponding to a region with amino acids LPNGLAITTNTSQKYIFVSLLSRDSVYDLLRRVCTHLQPSSKKSLSVREF</p>

<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the class of rifamycins. Specifically designed to combat tuberculosis infection, this compound exhibits strong bactericidal activity. It works by binding to DNA-dependent RNA polymerase, effectively inhibiting bacterial growth and preventing transcription and replication. Through various metabolic transformations, such as hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid, the active form of this drug is metabolized. Additionally, it specifically targets markers expressed at high levels in Mycobacterium tuberculosis strains and inhibits cell growth in culture.</p>

<p>Karyopherin Alpha 3 antibody was raised using a synthetic peptide corresponding to a region with amino acids AENPSLENHRIKSFKNKGRDVETMRRHRNEVTVELRKNKRDEHLLKKRNV</p>

<p>HCN3 antibody was raised using the middle region of HCN3 corresponding to a region with amino acids LQAAAVTSNVAIALTHQRGPLPLSPDSPATLLARSAWRSAGSPASPLVPV</p>

<p>Mouse monoclonal PTPRE antibody</p>

<p>Rat monoclonal CD44 antibody (FITC)</p>

<p>The NUMB antibody is a powerful tool in the field of life sciences. It belongs to the class of monoclonal antibodies and is specifically designed to neutralize the effects of tumor necrosis factor-alpha (TNF-α). This antibody has been extensively studied and proven to be effective in various research applications.</p>

<p>MAP3K4 antibody was raised in Rabbit using Human MAP3K4 as the immunogen</p>

<p>LSR antibody was raised in Rabbit using Human LSR as the immunogen</p>

<p>Purified recombinant H3F3A protein (His tag)</p>

<p>Mouse monoclonal ARL5B antibody</p>

<p>TEX264 antibody was raised using the middle region of TEX264 corresponding to a region with amino acids GWDDGDTRSEHSYSESGASGSSFEELDLEGEGPLGESRLDPGTEPLGTTK</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of GSTM2 antibody, catalog no. 70R-2848</p>

<p>NDST3 antibody was raised using a synthetic peptide corresponding to a region with amino acids PGTDWTVFQINHSAYQPVIFAKVKTPENLSPSISKGAFYATIIHDLGLHD</p>

<p>Rabbit polyclonal SNAI1 antibody (Ser246)</p>

<p>Rabbit polyclonal NDM1 antibody (biotin)</p>

<p>Sheep polyclonal Despropionyl Fentanyl antibody</p>

<p>The BSG antibody is a highly potent and specialized cytotoxic monoclonal antibody that has neutralizing properties. It is commonly used in immunoassays and other life science applications. This antibody specifically targets the glycoprotein known as BSG, which plays a crucial role in various cellular processes.</p>

<p>The p90RSK antibody is a polyclonal antibody used in the field of Life Sciences. It specifically targets actin, a protein involved in various cellular processes. The antibody has been proven effective in detecting activated p90RSK in human serum samples. This antibody is also utilized as a tool to study multidrug resistance and the development of pegylated inhibitors. Additionally, it has shown promising results in the detection of alpha-fetoprotein, an important biomarker for certain cancers. The p90RSK antibody can be used in combination with other antibodies to create nanocomposites for various applications such as glycation studies and visualization of actin filaments and collagen. Its high specificity and sensitivity make it an invaluable tool for researchers in the field.</p>

<p>Rabbit polyclonal NR2C2 antibody</p>

<p>SPON2 antibody was raised using the middle region of SPON2 corresponding to a region with amino acids GTDSGFTFSSPNFATIPQDTVTEITSSSPSHPANSFYYPRLKALPPIARV</p>

<p>Gentamicin-BSA is a unique monoclonal antibody that has been conjugated with bovine serum albumin (BSA). This conjugate is designed to specifically target and bind to epidermal growth factor (EGF) receptors on the surface of cells. By binding to these receptors, Gentamicin-BSA can inhibit the activity of farnesyl transferase, an enzyme involved in cell growth and division.</p>

<p>Mouse monoclonal PANK2 antibody</p>

<p>EDNRB antibody was raised in sheep using C-terminal peptide KANDHGYDNFRSSNN of rat ET(B) Receptor corresponding to amino acids 424 to 437 conjugated to KLH as the immunogen.</p>