Biochemicals and Reagents
Biochemicals and reagents are fundamental substances for research and development in fields such as biotechnology, molecular biology, pharmacology, and medicine. These products are essential for a variety of applications, including compound synthesis, biological sample analysis, metabolic process research, and drug production. At CymitQuimica, we offer a wide selection of high-quality, high-purity biochemicals and reagents suitable for various scientific and industrial needs. Our catalog includes enzymes, antibodies, nucleic acids, amino acids, and many other products, all designed to support researchers and professionals in their research and development projects, ensuring reliable and reproducible results.
Subcategories of "Biochemicals and Reagents"
- Biomolecules(98,569 products)
- By Biological Target(100,682 products)
- By Pharmacological Effects(6,934 products)
- Cryopreservatives(21 products)
- Desinfectants and Related Compounds(28 products)
- Hormones(383 products)
- Plant Biology(6,909 products)
- Secondary Metabolites(14,364 products)
Found 130473 products of "Biochemicals and Reagents"
Sort by
Purity (%)
0
100
|
0
|
50
|
90
|
95
|
100
KIAA1958 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of KIAA1958 antibody, catalog no. 70R-4141
Purity:Min. 95%Myeloperoxidase antibody
Myeloperoxidase antibody was raised in mouse using human myeloperoxidase as the immunogen.Ubiquitin antibody
The Ubiquitin antibody is a powerful tool used in the field of Life Sciences. It is a monoclonal antibody that specifically targets ubiquitin, a small protein involved in various cellular processes. This antibody has been extensively studied and validated for its specificity and sensitivity.SLC6A15 antibody
SLC6A15 antibody was raised using the N terminal of SLC6A15 corresponding to a region with amino acids DQCPLVKNASHTFVEPECEQSSATTYYWYREALNISSSISESGGLNWKMTPurity:Min. 95%SERPINB12 antibody
SERPINB12 antibody was raised in rabbit using residues 260-275 [SHSKDNLKGLEELERK] of the human SERPINB12 protein as the immunogen.Purity:Min. 95%KLHDC1 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of KLHDC1 antibody, catalog no. 70R-2991Purity:Min. 95%W-84 dibromide
CAS:W-84 dibromide is a chemical compound often categorized as a pharmacological research tool, which is typically synthesized in specialized laboratories focusing on medicinal chemistry and receptor research. This compound functions as a modulator, interacting with specific neurotransmitter receptors to influence signal transduction pathways. Researchers utilize W-84 dibromide to investigate the physiological roles of these receptors and their related pathways, helping to elucidate mechanisms of action at the molecular level.
Formula:C32H44Br2N4O4Purity:Min. 95%Molecular weight:708.52 g/molPI3 antibody
PI3 antibody was raised using a synthetic peptide corresponding to a region with amino acids KGRVPFNGQDPVKGQVSVKGQDKVKAQEPVKGPVSTKPGSCPIILIRCAM
Purity:Min. 95%PTS antibody
The PTS antibody is a highly specialized antibody used in the field of Life Sciences. It is designed to target specific proteins and molecules involved in various biological processes. This antibody can be used in research settings to study the role of these proteins and their interactions with other molecules.Akt antibody (Ser129)
Protein kinase B, also known as Akt or RAC-alpha serine/threonine-protein kinase, is a serum- and glucocorticoid-regulated kinase with three closely related isoforms: Akt1, Akt2, and Akt3. While Akt1 and Akt3 are primarily expressed in the brain, Akt2 is most abundant in skeletal muscle and embryonic brown fat. These isoforms are key regulators in various physiological functions, including cell growth, proliferation, survival, angiogenesis, and metabolism, and Akt is also recognized as a proto-oncogene due to its role in cancer-related processes.9-(3-Pent-4-ynyl-3-H-diazirin-3-yl)-nonanoic acid
CAS:9-(3-Pent-4-ynyl-3-H-diazirin-3-yl)-nonanoic acid is a fatty acid that is found in the bovine rumen. It has been shown to have analgesic properties and has been used as a model to study pain mechanisms. 9-(3-Pent-4-ynyl-3-H-diazirin-3-yl)-nonanoic acid interacts with mirnas and can be used for diagnosis of chronic arthritis. This molecule has two functional groups: the carboxylic acid group and the ester group.Formula:C15H24N2O2Purity:Min. 95%Molecular weight:264.36 g/molASH2L antibody
ASH2L antibody was raised in mouse using recombinant Human Ash2 (Absent, Small, Or Homeotic)-Like (Drosophila) (Ash2L)Rabbit anti Bovine IgG
Rabbit anti-bovine IgG was raised in rabbit using bovine IgG F(ab')2 fragment as the immunogen.Purity:Min. 95%SGK1-IN-1
CAS:SGK1-IN-1 is a ligand that binds to the receptor, G protein-coupled receptor kinase 1 (GRK1). It is a selective inhibitor of GRK1. SGK1 is involved in the regulation of ion channels, and thus may be used as a research tool for studying ion channel function. The binding of SGK1-IN-1 to GRK1 inhibits the phosphorylation of receptors and prevents the activation of downstream signaling pathways. This inhibition could be useful as an anti-inflammatory agent or in treating cardiac arrhythmias.
Formula:C17H12ClFN6O2SPurity:Min. 95%Molecular weight:418.8 g/molTMEM135 antibody
TMEM135 antibody was raised using the N terminal of TMEM135 corresponding to a region with amino acids SLKIYAPLYLIAAILRKRKLDYYLHKLLPEILQSASFLTANGALYMAFFC
Purity:Min. 95%VEGFR3 antibody
The VEGFR3 antibody is a highly effective medicament used in the field of Life Sciences. It is specifically designed to target and neutralize the activity of VEGFR3, a protein kinase involved in endothelial growth and development. This antibody is derived from Polyclonal Antibodies, ensuring high specificity and potency.Purity:Min. 95%HRB Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of HRB antibody, catalog no. 70R-4741Purity:Min. 95%HECTD2 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of HECTD2 antibody, catalog no. 70R-2368
Purity:Min. 95%KBTBD10 antibody
KBTBD10 antibody was raised in rabbit using the C terminal of KBTBD10 as the immunogenPurity:Min. 95%AKAP7 antibody
AKAP7 antibody was raised using a synthetic peptide corresponding to a region with amino acids MKLSKSPWLRKNGVKKIDPDLYEKFISHRFGEEILYRIDLCSMLKKKQSNRRAS2 protein (His tag)
1-201 amino acids: MGSSHHHHHH SSGLVPRGSH MAAAGWRDGS GQEKYRLVVV GGGGVGKSAL TIQFIQSYFV TDYDPTIEDS YTKQCVIDDR AARLDILDTA GQEEFGAMRE QYMRTGEGFL LVFSVTDRGS FEEIYKFQRQ ILRVKDRDEF PMILIGNKAD LDHQRQVTQE EGQQLARQLK VTYMEASAKI RMNVDQAFHE LVRVIRKFQE QECPPSPEPT RKEKDKKGCH CPurity:Min. 95%LMF1 antibody
LMF1 antibody was raised using the N terminal of LMF1 corresponding to a region with amino acids MRPDSPTMAAPAESLRRRKTGYSDPEPESPPAPGRGPAGSPAHLHTGTFWPurity:Min. 95%AHCYL1 antibody
AHCYL1 antibody was raised using the N terminal of AHCYL1 corresponding to a region with amino acids TDSYSSAASYTDSSDDEVSPREKQQTNSKGSSNFCVKNIKQAEFGRREIECSK antibody
The CSK antibody is a highly reactive and neutralizing antibody that targets the activated form of calmodulin. This polyclonal antibody is widely used in life sciences research, particularly in studies related to growth factors and adipose tissue. It has also been shown to have a neutralizing effect on influenza hemagglutinin, making it a valuable tool for studying viral infections. The CSK antibody is available as both polyclonal and monoclonal antibodies, providing researchers with options for their specific experimental needs. With its ability to inhibit the activity of calmodulin-dependent enzymes such as 3-kinase and solute diuretic, this antibody offers great potential for further understanding cellular signaling pathways.Purity:Min. 95%FABP3 antibody
FABP3 antibody was raised using a synthetic peptide corresponding to a region with amino acids MTKPTTIIEKNGDILTLKTHSTFKNTEISFKLGVEFDETTADDRKVKSIV
TIMP3 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of TIMP3 antibody, catalog no. 70R-9697Purity:Min. 95%ANKRD5 antibody
ANKRD5 antibody was raised using the N terminal of ANKRD5 corresponding to a region with amino acids MTIVDNEGKGVLFYCILPTKRHYRCALIALEHGADVNNSTYEGKPIFLRALZTFL1 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of LZTFL1 antibody, catalog no. 70R-1291Purity:Min. 95%GALR2 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of GALR2 antibody, catalog no. 70R-10309
Purity:Min. 95%ATB 346
CAS:ATB 346 is a nonsteroidal anti-inflammatory drug that works by inhibiting cyclooxygenase (COX) and lipoxygenase enzymes. It has been shown to inhibit COX-2, which is involved in the production of prostaglandin E2 and thromboxane A2, and is thought to be responsible for the inflammatory response. ATB 346 has been demonstrated to reduce inflammation in an experimental model of abdominal surgery in rats. This drug also inhibits the release of histamine and other proinflammatory substances by blocking the activity of neurotrophic factors such as nerve growth factor or brain-derived neurotrophic factor.Formula:C21H19NO3SPurity:Min. 95%Molecular weight:365.45 g/molGILZ antibody
The GILZ antibody is a growth factor that has been widely used as a diagnostic agent in various fields of research, including Life Sciences. It is a cationic antibody that exhibits strong biological effects and can be used as a fluorescent probe or photocatalytic agent. The GILZ antibody is typically conjugated with pluronic p123 to enhance its particle chemiluminescence properties. This monoclonal antibody specifically targets and binds to the antigen binding domain, allowing for accurate detection and analysis of specific molecules or proteins. With its activated state and high affinity for target antigens, the GILZ antibody provides researchers with a powerful tool for studying cellular processes and identifying potential therapeutic targets.CREB3L1 antibody
CREB3L1 antibody was raised in rabbit using the N terminal of CREB3L1 as the immunogenPurity:Min. 95%FZD5 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of FZD5 antibody, catalog no. 70R-7475Purity:Min. 95%TRAK1 antibody
TRAK1 antibody was raised in rabbit using the middle region of TRAK1 as the immunogenPurity:Min. 95%TRPV4 antibody
TRPV4 antibody was raised using the middle region of TRPV4 corresponding to a region with amino acids RVDEVNWSHWNQNLGIINEDPGKNETYQYYGFSHTVGRLRRDRWSSVVPRPurity:Min. 95%NAP2 antibody
NAP2 antibody was raised in mouse using highly pure recombinant human NAP-2 as the immunogen.ST8SIA2 antibody
ST8SIA2 antibody was raised using the C terminal of ST8SIA2 corresponding to a region with amino acids TGLLMYTLATRFCKQIYLYGFWPFPLDQNQNPVKYHYYDSLKYGYTSQASPurity:Min. 95%SORL1 antibody
SORL1 antibody was raised in Mouse using a purified recombinant fragment of human SORL1 expressed in E. coli as the immunogen.Goat anti Human IgG (biotin)
This antibody reacts with heavy chains on human IgG (gamma chain).Purity:Min. 95%Receptor Tyrosine Phosphatase Beta Ab
Receptor Tyrosine Phosphatase Beta (phosphacan) Monoclonal AntibodyRUVBL1 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of RUVBL1 antibody, catalog no. 70R-3144Purity:Min. 95%NVS-CRF-38
CAS:NVS-CRF-38 is a corticotropin-releasing factor (CRF) analog. It is a conjugated form of the CRF-III peptide, which has been modified to contain a phenylalanine residue at position 3 and an arginine residue at position 9. The test compound binds to the CRF receptor and acts as a partial agonist. NVS-CRF-38 has been shown to have pharmacokinetic properties similar to those of native CRF in rats and humans. In rats, plasma protein binding was ˜80% with no effect by deuterium isotope on drug pharmacokinetics. In humans, it was found that NVS-CRF-38 had high oral bioavailability and good absorption in the small intestine.Formula:C19H21N5O2Purity:Min. 95%Molecular weight:351.4 g/molUNC2250
CAS:UNC2250 is a monoclonal antibody that binds to the death protein, which is involved in apoptosis. It has been shown to be a potent inhibitor of colony-stimulating factor (CSF) and has a novel mechanism of action. UNC2250 binds to the intramolecular hydrogen in the death protein, preventing it from binding to other proteins and inhibiting their activity. This leads to inhibition of cell proliferation and apoptosis induction. UNC2250 also prevents platelet aggregation by inhibiting ADP-induced activation of phospholipase A2. UNC2250 has pharmacokinetic properties that are similar to those of erythropoietin because they both bind to the same receptor on cells. The hydroxyl group on UNC2250 allows it to form hydrogen bonds with water molecules, while the hydrogen bond between UNC2250 and erythropoietin prevents the latter from forming hydrogen bonds with water molecules.Formula:C24H36N6O2Purity:Min. 95%Molecular weight:440.58 g/molRPS6KB1 antibody
RPS6KB1 antibody was raised using the N terminal of RPS6KB1 corresponding to a region with amino acids KFEISETSVNRGPEKIRPECFELLRVLGKGGYGKVFQVRKVTGANTGKIF
Tetrapotassium, 2-[2-[2-[3-(1,3-benzothiazol-2-yl)-7-[bis(carboxylatomethyl)amino]-2-oxochromen-6-yl]oxyethoxy]-N-(carboxylatomethyl )-4-methylanilino]acetate
CAS:Tetrapotassium, 2-[2-[2-[3-(1,3-benzothiazol-2-yl)-7-[bis(carboxylatomethyl)amino]-2-oxochromen-6-yl]oxyethoxy]-N-(carboxylatomethyl )-4-methylanilino]acetate is a peptide that inhibits the activity of ion channels. It is a potent inhibitor of voltage gated sodium channels and potassium channels. Tetrapotassium, 2-[2-[2-[3-(1,3-benzothiazol-2-yl)-7-[bis(carboxylatomethyl)amino]-2-oxochromen-6-yl]oxyethoxy]-N-(carboxylatomethyl )-4-methylanilino]acetate has been used as a research tool to study protein interactions, activators, ligandsFormula:C33H25K4N3O12SPurity:Min. 95%Molecular weight:844 g/molSynaptotagmin antibody
The Synaptotagmin antibody is a highly specialized globulin that is used in various research and medical applications. This antibody specifically targets and neutralizes synaptotagmin, a protein involved in neurotransmitter release at the synapse. It has been extensively studied and characterized for its ability to inhibit lipoprotein lipase activity, making it an important tool in lipid metabolism research.Purity:Min. 95%BRSV antibody
BRSV antibody was raised in rabbit using residues 201-211 [KELLPKVNNHDC] of the 63 kDa BRSV F protein as the immunogen.Purity:Min. 95%eEF2 antibody
The eEF2 antibody is a monoclonal antibody that targets and binds to the eukaryotic elongation factor 2 (eEF2). This antibody plays a crucial role in cholinergic and dopamine signaling pathways. It has been extensively used in research within the field of Life Sciences to study the function and regulation of eEF2.CK1 delta antibody
CK1 delta antibody was raised in goat using residues 310-327 of human casein kinase 1d located at the C-terminus as the immunogen.Purity:Min. 95%KCNK9 antibody
KCNK9 antibody was raised using the N terminal of KCNK9 corresponding to a region with amino acids REEEKLKAEEIRIKGKYNISSEDYRQLELVILQSEPHRAGVQWKFAGSFYPurity:Min. 95%Dynactin 2 antibody
Dynactin 2 antibody was raised using a synthetic peptide corresponding to a region with amino acids ADPKYADLPGIARNEPDVYETSDLPEDDQAEFDAFAQELEELTSTSVEHIPurity:Min. 95%Histone H3 antibody
The Histone H3 antibody is a powerful tool used in Life Sciences research. It is a monoclonal antibody that specifically targets histone H3, a protein involved in the regulation of gene expression and chromatin structure. This antibody has been extensively validated for use in various applications, including immunohistochemistry, western blotting, and chromatin immunoprecipitation.
CNN2 antibody
The CNN2 antibody is a highly specialized monoclonal antibody that targets the CNN2 protein. This protein is involved in various cellular processes, including glycosylation and mineralization. It plays a crucial role in human folate metabolism and growth factor signaling. The CNN2 antibody specifically binds to the collagen domain of the CNN2 protein, blocking its activity and preventing downstream effects.PKR antibody
PKR antibody is a specific antibody used in Life Sciences for various applications. It can be utilized as a vaccine adjuvant composition, enhancing the immune response to vaccines. This monoclonal antibody has been extensively studied and proven effective in phenotypic assays, such as intravascular hemolysis. Additionally, it has shown promising results in the development of recombinant vaccinia-based anticancer agents.Purity:Min. 95%ANP (Human, 7-28)
CAS:ANP (Human, 7-28) is a peptide with inhibitor activity. ANP (Human, 7-28) binds to the receptor for atrial natriuretic peptide and inhibits its interaction with other proteins. It can also activate the receptor by binding to it. ANP (Human, 7-28) contains an N-terminal sequence of amino acids that are not present in the human atrial natriuretic peptide and can be used as a research tool or an antibody against this protein.
Formula:C100H153N33O30S3Purity:Min. 95%Molecular weight:2,393.7 g/molBBS2 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of BBS2 antibody, catalog no. 70R-9878Purity:Min. 95%RAB39B antibody
RAB39B antibody was raised using the N terminal of RAB39B corresponding to a region with amino acids MEAIWLYQFRLIVIGDSTVGKSCLIRRFTEGRFAQVSDPTVGVDFFSRLV
Purity:Min. 95%Acepromazine Maleate
CAS:Acepromazine Maleate (USP grade powder) chemical reference substanceFormula:C19H22N2OSC4H4O4Purity:Min. 95%KCNAB2 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of KCNAB2 antibody, catalog no. 70R-1486Purity:Min. 95%CD11b antibody
The CD11b antibody is a highly specific monoclonal antibody that targets the CD11b protein. This protein is involved in various cellular processes, including cell adhesion and migration. The CD11b antibody has been extensively studied for its inhibitory effects on the 5-ht1a serotonin receptor, which plays a crucial role in neurotransmission.SLC22A11 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of SLC22A11 antibody, catalog no. 70R-7369Purity:Min. 95%Exodus 2 antibody
Exodus 2 antibody was raised in rabbit using highly pure recombinant murine exodus-2 as the immunogen.Purity:Min. 95%CACNB2 antibody
CACNB2 antibody was raised using the N terminal of CACNB2 corresponding to a region with amino acids MNQGSGLDLLKISYGKGARRKNRFKGSDGSTSSDTTSNSFVRQGSADSYTUSP26 antibody
USP26 antibody was raised in rabbit using the middle region of USP26 as the immunogenPurity:Min. 95%Cyclooctyne-o-pfp ester
CAS:Cyclooctyne-o-pfp ester is a cyclic compound that binds to and inhibits the activity of protein ligands. It is used for pharmacological research on peptides and proteins. Cyclooctyne-o-pfp ester has been shown to be an activator for some receptors, such as the beta adrenergic receptor. This compound also binds to ion channels, such as potassium channels, and can inhibit their function by blocking potassium ions from passing through. Cyclooctyne-o-pfp ester is available in high purity and can be used in research on life sciences, antibodies, or ion channels.Formula:C16H13F5O3Purity:Min. 95%Molecular weight:348.26 g/mol
![Tetrapotassium, 2-[2-[2-[3-(1,3-benzothiazol-2-yl)-7-[bis(carboxylatomethyl)amino]-2-oxochromen-6-…](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FRIA45354.webp&w=3840&q=75)
