Biochemicals and Reagents
Subcategories of "Biochemicals and Reagents"
- Biomolecules(98,575 products)
- By Biological Target(100,710 products)
- By Pharmacological Effects(6,937 products)
- Cryopreservatives(21 products)
- Desinfectants and Related Compounds(28 products)
- Hormones(421 products)
- Plant Biology(6,907 products)
- Secondary Metabolites(14,367 products)
Found 130493 products of "Biochemicals and Reagents"
CDKN2B antibody
CDKN2B antibody was raised in rabbit using the middle region of CDKN2B as the immunogenACCN5 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of ACCN5 antibody, catalog no. 70R-1510Purity:Min. 95%FKHR antibody
FKHR antibody is a growth factor that acts as a protein kinase. This antibody specifically targets FKHR, which is involved in various cellular processes such as cell growth, proliferation, and survival. The effective dose of this monoclonal antibody has been determined through extensive research and testing. FKHR antibody has been shown to have a high affinity for fatty acids and can effectively inhibit the binding of these molecules to their respective receptors. Additionally, this antibody has demonstrated the ability to block the activity of epidermal growth factor and collagen, two key regulators of cell function. Polyclonal antibodies targeting FKHR have also been developed and can be used for diagnostic purposes. These antibodies are colloidal in nature and have shown excellent specificity and sensitivity when used in assays such as immunohistochemistry or ELISA. Furthermore, FKHR antibody has been found to modulate the expression of chemokines and transforming growth factor-beta (TGF-beta), suggesting its potential role in immune regulation and inflammation control.
Purity:Min. 95%CCDC96 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of CCDC96 antibody, catalog no. 70R-3730
Purity:Min. 95%LRRC33 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of LRRC33 antibody, catalog no. 70R-7519Purity:Min. 95%GluR1 antibody
The GluR1 antibody is a powerful tool in the field of Life Sciences. It is a polyclonal antibody that specifically targets the GluR1 receptor, which plays a crucial role in mediating glutamate signaling in the brain. This antibody has been extensively tested and validated for its high specificity and sensitivity.EIF2S1 antibody
EIF2S1 antibody was raised using the C terminal of EIF2S1 corresponding to a region with amino acids RGVFNVQMEPKVVTDTDETELARQMERLERENAEVDGDDDAEEMEAKAEDTransferrin Receptor protein (concentrate)
Native Human Transferrin Receptor concentratePurity:Min. 95%EDIL3 antibody
EDIL3 antibody was raised in rabbit using the N terminal of EDIL3 as the immunogenPurity:Min. 95%SERPINH1 antibody
SERPINH1 antibody was raised in rabbit using the C terminal of SERPINH1 as the immunogenPurity:Min. 95%NRIP3 antibody
NRIP3 antibody was raised in rabbit using the middle region of NRIP3 as the immunogenPurity:Min. 95%BRUNOL6 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of BRUNOL6 antibody, catalog no. 70R-4726Purity:Min. 95%Influenza A antibody (H3N2) (HRP)
Influenza A antibody (H3N2) (HRP) was raised in goat using Influenza A, strain Texas 1/77 (H3N2) as the immunogen.BHMT antibody
BHMT antibody was raised using the N terminal of BHMT corresponding to a region with amino acids AVEHPEAVRQLHREFLRAGSNVMQTFTFYASEDKLENRGNYVLEKISGQE
LYN antibody
LYN antibody was raised in Mouse using a purified recombinant fragment of LYN expressed in E. coli as the immunogen.PDK1 antibody
The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the class of rifamycins. It is highly effective in treating tuberculosis infections due to its bactericidal activity. This active compound works by binding to DNA-dependent RNA polymerase, preventing transcription and replication of bacteria. Its efficacy has been proven through extensive research using the patch-clamp technique on human erythrocytes. The drug undergoes various metabolic transformations, including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, it specifically targets markers expressed in Mycobacterium tuberculosis strains and inhibits their growth in culture.Purity:Min. 95%GSTK1 antibody
GSTK1 antibody was raised using the middle region of GSTK1 corresponding to a region with amino acids NLEHPEMLEKASRELWMRVWSRNEDITEPQSILAAAEKAGMSAEQAQGLLCD61 antibody
The CD61 antibody is a highly specialized antibody-drug that belongs to the class of antibodies known as polyclonal antibodies. It is specifically designed to target a specific antigen, known as CD61, which plays a crucial role in various biological processes including chemokine signaling and immune response. This antibody is widely used in research and diagnostic applications such as immunohistochemistry and flow cytometry.
SLC7A11 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of SLC7A11 antibody, catalog no. 70R-6800Purity:Min. 95%SH3BGRL antibody
SH3BGRL antibody was raised using the middle region of SH3BGRL corresponding to a region with amino acids PQIFNESQYRGDYDAFFEARENNAVYAFLGLTAPPGSKEAEVQAKQQAMyc antibody
The Myc antibody is a polyclonal antibody that specifically targets the epidermal growth factor receptor (EGFR). It is commonly used in life sciences research for applications such as immunoassays, immunohistochemistry, and western blotting. This antibody has high affinity and specificity for EGFR, making it an ideal tool for studying the role of this receptor in various biological processes.Purity:Min. 95%EFCAB3 antibody
EFCAB3 antibody was raised using the N terminal of EFCAB3 corresponding to a region with amino acids MAVSEIKPKLKLNPLTKVPISHNKRDRDLPGSLQCQLQHKEKKLSASQMAOBOX6 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of OBOX6 antibody, catalog no. 20R-1165Purity:Min. 95%CES6 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of CES6 antibody, catalog no. 20R-1163Purity:Min. 95%TARBP2 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of TARBP2 antibody, catalog no. 70R-1374
Purity:Min. 95%TDG antibody
The TDG antibody is a highly specific monoclonal antibody that targets the glycan structures on glycoproteins. It is widely used in life sciences research to study the role of glycans in various biological processes. The TDG antibody can be used for applications such as lectin blotting, glycan profiling, and immunohistochemistry. This antibody recognizes a polymorphic epitope that is activated by fatty acid treatment, making it a valuable tool for studying changes in glycosylation patterns. Additionally, the TDG antibody has been shown to interact with epithelial cadherin, suggesting a potential role in cell adhesion and signaling pathways. With its high specificity and sensitivity, this monoclonal antibody is an essential tool for researchers studying glycan-related processes in human proteins.
Vitamin D antibody
The Vitamin D antibody is an essential tool for immunoassays in the field of Life Sciences. This antibody is specifically designed to bind to Vitamin D and its metabolites, allowing for accurate detection and measurement in various assays. The antibody is highly specific and can be used in a variety of applications, including ELISA, Western blotting, and immunohistochemistry.MLC1 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of MLC1 antibody, catalog no. 70R-5137Purity:Min. 95%PLEKHB2 antibody
PLEKHB2 antibody was raised using a synthetic peptide corresponding to a region with amino acids AYGYGPYGGAYPPGTQVVYAANGQAYAVPYQYPYAGLYGQQPANQVIIRESTAU1 antibody
STAU1 antibody was raised using a synthetic peptide corresponding to a region with amino acids LSVGGQQFNGKGKTRQAAKHDAAAKALRILQNEPLPERLEVNGRESEEENRabbit anti Mouse Lambda Chain (biotin)
Rabbit anti-mouse lambda chain (biotin) was raised in rabbit using murine lambda light chain as the immunogen.Purity:Min. 95%SLC10A4 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of SLC10A4 antibody, catalog no. 70R-6295Purity:Min. 95%cRAF antibody
The cRAF antibody is a polyclonal antibody used in Life Sciences research. It specifically targets the cRAF protein, a tyrosine kinase receptor involved in various cellular processes such as endothelial growth and collagen synthesis. This antibody can be used to study the role of cRAF in signal transduction pathways and its interaction with other proteins and growth factors. Additionally, the cRAF antibody has been shown to have potential therapeutic applications, including the treatment of autoimmune disorders and certain types of cancer. Its high specificity and affinity make it a valuable tool for researchers studying protein-protein interactions and signaling pathways involving cRAF.VDAC2 antibody
VDAC2 antibody was raised using the N terminal of VDAC2 corresponding to a region with amino acids VKLDVKTKSCSGVEFSTSGSSNTDTGKVTGTLETKYKWCEYGLTFTEKWNZNF91 antibody
ZNF91 antibody was raised in rabbit using the N terminal of ZNF91 as the immunogenPurity:Min. 95%IMP3 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of IMP3 antibody, catalog no. 70R-4709Purity:Min. 95%MIP5 protein
Region of MIP5 protein corresponding to amino acids QFTNDAETEL MMSKLPLENP VVLNSFHFAA DCCTSYISQS IPCSLMKSYF ETSSECSKPG VIFLTKKGRQ VCAKPSGPGV QDCMKKLKPY SI.Purity:Min. 95%NUP98 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of NUP98 antibody, catalog no. 70R-5608Purity:Min. 95%HADH antibody
HADH antibody was raised in rabbit using the middle region of HADH as the immunogenPurity:Min. 95%AK2 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of AK2 antibody, catalog no. 70R-3439Purity:Min. 95%SMYD4 antibody
SMYD4 antibody was raised in rabbit using the N terminal of SMYD4 as the immunogenPurity:Min. 95%Keratin 10 antibody
The Keratin 10 antibody is a highly specialized antibody that plays a crucial role in various biological processes. It is a protein-coupled receptor that binds to glutamate and acts as a heparin cofactor. This antibody is commonly used in Life Sciences research, particularly in the study of fetal hemoglobin and its regulation. Additionally, it has been extensively utilized in the field of medicine for the development of targeted therapies and diagnostic tools.Rabbit anti Chicken IgG (H + L) (FITC)
Rabbit anti-chicken IgG (H+L) (FITC) was raised in rabbit using chicken IgG whole molecule as the immunogen.Purity:Min. 95%SEPN1 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of SEPN1 antibody, catalog no. 70R-8737Purity:Min. 95%C1orf104 antibody
C1orf104 antibody was raised using the middle region of C1orf104 corresponding to a region with amino acids APLSCPAPRAQVHRSTPMGRALLTRVLLEPLRPWACPRLPRSPPGGAQSG
NCX1 antibody
The NCX1 antibody is a monoclonal antibody that specifically targets the NCX1 protein. It is widely used in life sciences research to study the role of NCX1 in various cellular processes. This antibody has been shown to bind to NCX1 with high specificity and affinity, making it an ideal tool for studying the function and regulation of this protein.FTH1 protein
1-183 amino acids: MTTASTSQVR QNYHQDSEAA INRQINLELY ASYVYLSMSY YFDRDDVALK NFAKYFLHQS HEEREHAEKL MKLQNQRGGR IFLQDIKKPD CDDWESGLNA MECALHLEKN VNQSLLELHK LATDKNDPHL CDFIETHYLN EQVKAIKELG DHVTNLRKMG APESGLAEYL FDKHTLGDSD NESPurity:Min. 95%Goat anti Monkey IgG (H + L) (Alk Phos)
Goat anti Monkey IgG (H + L) secondary antibody (Alk Phos)Purity:Min. 95%SLC7A1 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of SLC7A1 antibody, catalog no. 70R-6772Purity:Min. 95%Rabbit anti Sheep IgG (FITC)
Rabbit anti-sheep IgG (FITC) was raised in rabbit using sheep IgG F(ab')2 fragment as the immunogen.Purity:Min. 95%FAM50B Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of FAM50B antibody, catalog no. 70R-4226Purity:Min. 95%Lp-PLA2 monoclonal antibody
Lp-PLA2 monoclonal antibody is a powerful tool in the field of Life Sciences. This monoclonal antibody specifically targets and neutralizes Lp-PLA2, an enzyme involved in the formation of plaques in blood vessels. By inhibiting the activity of Lp-PLA2, this antibody helps to reduce inflammation and prevent the progression of cardiovascular diseases.ZNF266 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of ZNF266 antibody, catalog no. 70R-8283
Purity:Min. 95%GPR75 antibody
The GPR75 antibody is a highly effective neutralizing monoclonal antibody used in Life Sciences. It is specifically designed to target and inhibit the activity of GPR75, a hormone peptide receptor involved in various cellular processes. This antibody has been extensively studied and proven to have cytotoxic effects on cells expressing high levels of GPR75. Additionally, it has shown promising results in inhibiting the growth of collagen-producing cells and reducing lipoprotein lipase activity. The GPR75 antibody can be used as a powerful tool for research purposes, as well as in the development of therapeutic interventions targeting GPR75-mediated pathways. Its multidrug resistance properties make it an excellent candidate for combination therapy with other antibodies or antibiotics to enhance treatment efficacy.LRRC28 antibody
LRRC28 antibody was raised using the C terminal of LRRC28 corresponding to a region with amino acids KDLNFLSPISLPRSLLELLHCPLGHCHRCSEPMFTIVYPKLFPLRETPMAPDGF AA protein
Region of PDGF AA protein corresponding to amino acids MSIEEAVPAV CKTRTVIYEI PRSQVDPTSA NFLIWPPCVE VKRCTGCCNT SSVKCQPSRV HHRSVKVAKV EYVRKKPKLK EVQVRLEEHL ECACATSNLN PDHREEETGR RRESGKNRKR KRLKPT.
Purity:Min. 95%Tropomodulin 3 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of TMOD3 antibody, catalog no. 70R-3615Purity:Min. 95%
