Biochemicals and Reagents
Biochemicals and reagents are fundamental substances for research and development in fields such as biotechnology, molecular biology, pharmacology, and medicine. These products are essential for a variety of applications, including compound synthesis, biological sample analysis, metabolic process research, and drug production. At CymitQuimica, we offer a wide selection of high-quality, high-purity biochemicals and reagents suitable for various scientific and industrial needs. Our catalog includes enzymes, antibodies, nucleic acids, amino acids, and many other products, all designed to support researchers and professionals in their research and development projects, ensuring reliable and reproducible results.
Subcategories of "Biochemicals and Reagents"
- Biomolecules(98,575 products)
- By Biological Target(100,728 products)
- By Pharmacological Effects(6,938 products)
- Cryopreservatives(21 products)
- Desinfectants and Related Compounds(28 products)
- Hormones(440 products)
- Plant Biology(6,906 products)
- Secondary Metabolites(14,368 products)
Found 130509 products of "Biochemicals and Reagents"
Sort by
Purity (%)
0
100
|
0
|
50
|
90
|
95
|
100
C1orf104 antibody
C1orf104 antibody was raised using the middle region of C1orf104 corresponding to a region with amino acids APLSCPAPRAQVHRSTPMGRALLTRVLLEPLRPWACPRLPRSPPGGAQSG
NCX1 antibody
The NCX1 antibody is a monoclonal antibody that specifically targets the NCX1 protein. It is widely used in life sciences research to study the role of NCX1 in various cellular processes. This antibody has been shown to bind to NCX1 with high specificity and affinity, making it an ideal tool for studying the function and regulation of this protein.FTH1 protein
1-183 amino acids: MTTASTSQVR QNYHQDSEAA INRQINLELY ASYVYLSMSY YFDRDDVALK NFAKYFLHQS HEEREHAEKL MKLQNQRGGR IFLQDIKKPD CDDWESGLNA MECALHLEKN VNQSLLELHK LATDKNDPHL CDFIETHYLN EQVKAIKELG DHVTNLRKMG APESGLAEYL FDKHTLGDSD NESPurity:Min. 95%Goat anti Monkey IgG (H + L) (Alk Phos)
Goat anti Monkey IgG (H + L) secondary antibody (Alk Phos)Purity:Min. 95%SLC7A1 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of SLC7A1 antibody, catalog no. 70R-6772Purity:Min. 95%Rabbit anti Sheep IgG (FITC)
Rabbit anti-sheep IgG (FITC) was raised in rabbit using sheep IgG F(ab')2 fragment as the immunogen.Purity:Min. 95%FAM50B Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of FAM50B antibody, catalog no. 70R-4226Purity:Min. 95%Lp-PLA2 monoclonal antibody
Lp-PLA2 monoclonal antibody is a powerful tool in the field of Life Sciences. This monoclonal antibody specifically targets and neutralizes Lp-PLA2, an enzyme involved in the formation of plaques in blood vessels. By inhibiting the activity of Lp-PLA2, this antibody helps to reduce inflammation and prevent the progression of cardiovascular diseases.ZNF266 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of ZNF266 antibody, catalog no. 70R-8283
Purity:Min. 95%GPR75 antibody
The GPR75 antibody is a highly effective neutralizing monoclonal antibody used in Life Sciences. It is specifically designed to target and inhibit the activity of GPR75, a hormone peptide receptor involved in various cellular processes. This antibody has been extensively studied and proven to have cytotoxic effects on cells expressing high levels of GPR75. Additionally, it has shown promising results in inhibiting the growth of collagen-producing cells and reducing lipoprotein lipase activity. The GPR75 antibody can be used as a powerful tool for research purposes, as well as in the development of therapeutic interventions targeting GPR75-mediated pathways. Its multidrug resistance properties make it an excellent candidate for combination therapy with other antibodies or antibiotics to enhance treatment efficacy.LRRC28 antibody
LRRC28 antibody was raised using the C terminal of LRRC28 corresponding to a region with amino acids KDLNFLSPISLPRSLLELLHCPLGHCHRCSEPMFTIVYPKLFPLRETPMAPDGF AA protein
Region of PDGF AA protein corresponding to amino acids MSIEEAVPAV CKTRTVIYEI PRSQVDPTSA NFLIWPPCVE VKRCTGCCNT SSVKCQPSRV HHRSVKVAKV EYVRKKPKLK EVQVRLEEHL ECACATSNLN PDHREEETGR RRESGKNRKR KRLKPT.
Purity:Min. 95%Tropomodulin 3 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of TMOD3 antibody, catalog no. 70R-3615Purity:Min. 95%CD90.2 antibody
CD90.2 antibody was raised in rat using CD90.2/`Thy-1.2 alloantigen as the immunogen.
PEA15 antibody
The PEA15 antibody is a highly specialized monoclonal antibody used in the field of Life Sciences. It is specifically designed to target and inhibit the activity of creatine 3-kinase, a key enzyme involved in cellular growth and signaling pathways. This antibody has been extensively tested and validated using human serum samples, demonstrating its high specificity and efficacy.GABARAP antibody
GABARAP antibody was raised in rabbit using the C terminal of GABARAP as the immunogenPurity:Min. 95%CDC37 antibody
The CDC37 antibody is a monoclonal antibody that specifically targets CDC37, a protein that plays a crucial role in cell signaling and protein folding. This antibody has been extensively studied in the field of Life Sciences and has shown promising results in various applications. It can be used for research purposes such as immunoprecipitation, Western blotting, and immunohistochemistry.RAD18 antibody
The RAD18 antibody is a highly specific monoclonal antibody that targets the RAD18 protein. It has been widely used in Life Sciences research and diagnostics. This antibody is derived from mouse monoclonal antibodies and has been extensively characterized for its biophysical properties. The RAD18 antibody can be used for various applications, including Western blotting, immunoprecipitation, and immunohistochemistry. It has shown high affinity and specificity for the target protein in human serum samples. Additionally, this antibody has been utilized in studies involving botulinum toxin research, phosphatase activity assays, and adeno-associated virus-mediated gene delivery. Its ability to bind to the cytosolic protein RAD18 makes it an invaluable tool for researchers working in the field of DNA repair and replication. Whether you're studying cell signaling pathways or investigating disease mechanisms, the RAD18 antibody is an essential reagent to have in your lab arsenal.Synapsin antibody
The Synapsin antibody is a highly specialized monoclonal antibody used in the field of Life Sciences. It has been extensively tested and proven to have high affinity for the target receptor, making it an excellent tool for research purposes. This antibody specifically binds to activated receptors and exhibits neutralizing properties, effectively blocking their function. Additionally, it has been shown to interact with chemokines and phosphatases, further expanding its potential applications in various experimental settings. The Synapsin antibody is also capable of binding to alpha-fetoprotein and calmodulin, two important proteins involved in growth factor signaling pathways. Its versatility extends to adipose tissue studies as well, where it can be used to investigate cellular processes related to fat metabolism. With its reliable performance and compatibility with various detection methods such as immunofluorescence or Western blotting, this monoclonal antibody is an invaluable asset for researchers seeking to advance their understanding of complex biological systems.Purity:Min. 95%Rabbit anti Sheep IgG (H + L) (rhodamine)
Rabbit anti-sheep IgG (H+L) (Rhodamine) was raised in rabbit using sheep IgG whole molecule as the immunogen.Purity:Min. 95%Rabbit anti Rat IgG (FITC)
Rabbit anti-rat IgG (FITC) was raised in rabbit using rat IgG F(ab')2 fragment as the immunogen.Purity:Min. 95%Elk1 antibody
The Elk1 antibody is a monoclonal antibody that targets the Elk1 protein, which plays a crucial role in midbrain dopaminergic function. This antibody has been extensively studied in the field of Life Sciences and has shown promising results in various research applications.SLC12A1 antibody
SLC12A1 antibody was raised using a synthetic peptide corresponding to a region with amino acids NEKKSRGFFNYQASIFAENFGPRFTKGEGFFSVFAIFFPAATGILAGANI
Clusterin-Like 1 antibody
Clusterin-Like 1 antibody was raised using a synthetic peptide corresponding to a region with amino acids TEIIFNSIQVVPRIHEGNISKQDETMMTDLSILPSSNFTLKIPLEESAESUSP36 antibody
USP36 antibody was raised using the N terminal of USP36 corresponding to a region with amino acids SRHKSGDDPPARRQGSEHTYESCGDGVPAPQKVLFPTERLSLRWERVFRVGLUD2 antibody
GLUD2 antibody was raised using the N terminal of GLUD2 corresponding to a region with amino acids MYRYLAKALLPSRAGPAALGSAANHSAALLGRGRGQPAAASQPGLALAARNOB1 antibody
NOB1 antibody was raised using a synthetic peptide corresponding to a region with amino acids TEIRDKATRRRLAVLPYELRFKEPLPEYVRLVTEFSKKTGDYPSLSATDI
Eras antibody
Eras antibody was raised in rabbit using the N terminal of Eras as the immunogenPurity:Min. 95%PRKACB antibody
PRKACB antibody was raised in rabbit using the N terminal of PRKACB as the immunogen
Purity:Min. 95%MKK3 antibody
The MKK3 antibody is a highly specialized monoclonal antibody that targets the phosphatase MKK3. This antibody has been extensively studied for its role in various cellular processes, including the activation of endonucleases, regulation of β-catenin, and modulation of mitogen-activated protein (MAP) pathways. It has also been shown to interact with caspase-9, a key protein involved in apoptosis.SLFN12 antibody
SLFN12 antibody was raised using the middle region of SLFN12 corresponding to a region with amino acids KYLLKALFKALKRLKSLRDQFSFAENLYQIIGIDCFQKNDKKMFKSCRRL
SERINC2 antibody
SERINC2 antibody was raised in rabbit using the middle region of SERINC2 as the immunogenPurity:Min. 95%MUC1 antibody
MUC1 antibody was raised using the C terminal of MUC1 corresponding to a region with amino acids RRKNYGQLDIFPARDTYHPMSEYPTYHTHGRYVPPSSTDRSPYEKVSAGN53BP1 antibody
The 53BP1 antibody is a highly specific and potent monoclonal antibody that is used for various applications in research and diagnostics. This antibody binds to the macrophage-derived chemokine, neutralizing its activity and preventing its interaction with its receptor, C-C chemokine receptor. By blocking this interaction, the 53BP1 antibody can inhibit the recruitment of immune cells to the site of inflammation, providing a potential therapeutic benefit.RPS27L antibody
RPS27L antibody was raised using the N terminal of RPS27L corresponding to a region with amino acids MPLARDLLHPSLEEEKKKHKKKRLVQSPNSYFMDVKCPGCYKITTVFSHAANKRD54 antibody
ANKRD54 antibody was raised using the middle region of ANKRD54 corresponding to a region with amino acids EVHALKRLRDSANANDVETVQQLLEDGADPCAADDKGRTALHFASCNGNDKYNU antibody
KYNU antibody was raised using a synthetic peptide corresponding to a region with amino acids LAHAVGNVELYLHDWGVDFACWCSYKYLNAGAGGIAGAFIHEKHAHTIKPMICA antibody
MICA antibody was raised using the middle region of MICA corresponding to a region with amino acids LRRTVPPMVNVTRSEASEGNITVTCRASGFYPWNITLSWRQDGVSLSHDTVASP antibody
The VASP antibody is a highly specific monoclonal antibody that targets the vasodilator-stimulated phosphoprotein (VASP). This acidic family kinase inhibitor is widely used in research and diagnostic applications. The VASP antibody can be used for various immunoassays, including Western blotting, immunohistochemistry, and flow cytometry.Purity:Min. 95%CASP4 antibody
CASP4 antibody was raised in rabbit using the middle region of CASP4 as the immunogenPurity:Min. 95%CD8A antibody
CD8A antibody was raised in rabbit using the middle region of CD8A as the immunogenPurity:Min. 95%EGFR antibody
The EGFR antibody is a growth factor monoclonal antibody that specifically targets the epidermal growth factor receptor (EGFR). It contains carbonyl groups, histidine, and acid residues that enable it to bind to the EGFR protein. This antibody has been extensively studied and proven to have neutralizing effects on EGFR signaling pathways, making it an effective therapeutic option in the field of Life Sciences.Purity:Min. 95%OTUB2 antibody
OTUB2 antibody was raised in rabbit using the middle region of OTUB2 as the immunogen
Purity:Min. 95%NOLC1 antibody
NOLC1 antibody was raised using the C terminal of NOLC1 corresponding to a region with amino acids DNSFDAKRGAAGDWGERANQVLKFTKGKSFRHEKTKKKRGSYRGGSISVQ
Fibrinogen antibody (HRP)
Fibrinogen antibody (HRP) was raised in sheep using human Fibrinogen purified from plasma as the immunogen.HDAC8 antibody
The HDAC8 antibody is a highly specialized polyclonal antibody that specifically targets the human protein HDAC8. This antibody has been extensively tested and validated for its ability to detect and bind to HDAC8 in various experimental conditions. It is commonly used in research settings to study the role of HDAC8 in various cellular processes.
