Biochemicals and Reagents

<p>PRPF8 antibody was raised using a synthetic peptide corresponding to a region with amino acids SHRHSVKSQEPLPDDDEEFELPEFVEPFLKDTPLYTDNTANGIALLWAPR</p>

<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug from the class of rifamycins. It is highly effective in treating tuberculosis infections, thanks to its bactericidal activity. This compound works by binding to DNA-dependent RNA polymerase, which inhibits bacterial growth and prevents transcription and replication. Its efficacy has been demonstrated through extensive testing using the patch-clamp technique on human erythrocytes. The active form of this drug undergoes various metabolic transformations, including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, it specifically targets markers expressed at high levels in Mycobacterium tuberculosis strains and inhibits their cell growth in culture.</p>

<p>CD11c antibody was raised in rabbit using a synthetic peptide conjugated to KLH as the immunogen.</p>

<p>Rat monoclonal CD9 antibody (FITC)</p>

<p>Rabbit polyclonal MYT1 antibody (Ser83)</p>

<p>Rabbit polyclonal TMED3 antibody</p>

<p>Rabbit polyclonal HSPB2 antibody</p>

<p>Rabbit polyclonal MAP2K7 antibody (Thr275)</p>

<p>Rabbit Polyclonal OR4C3 antibody</p>

<p>Rabbit polyclonal MED14 antibody</p>

<p>Goat anti-rabbit IgG (Fab'2) (FITC) was raised in goat using rabbit IgG F(ab')2 fragment as the immunogen.</p>

<p>OVA conjugated Kanamycin Hapten</p>

<p>Recombinant Human PAX8 protein</p>

<p>HGS antibody was raised in Rabbit using Human HGS as the immunogen</p>

<p>Rabbit polyclonal MAP1LC3A antibody</p>

<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug belonging to the rifamycins class. It is specifically designed to combat tuberculosis infection by targeting active compounds and exerting bactericidal activity. This drug inhibits bacterial growth by binding to DNA-dependent RNA polymerase, preventing transcription and replication. Its effectiveness has been demonstrated through extensive research using advanced techniques like the patch-clamp technique on human erythrocytes. The drug undergoes various metabolic transformations such as hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Furthermore, it exhibits high affinity for markers expressed in Mycobacterium tuberculosis strains and effectively inhibits their growth in culture.</p>

<p>Purified recombinant TAF15 protein (His tag)</p>

<p>The CD40 antibody is a powerful tool used in the field of Life Sciences. It acts by binding to the CD40 protein, which plays a crucial role in various cellular processes. This antibody has been extensively studied and proven to have numerous applications.</p>

<p>NUDT18 antibody was raised using a synthetic peptide corresponding to a region with amino acids MASEGLAGALASVLAGQGSSVHSCDSAPAGEPPAPVRLRKNVCYVVLAVF</p>

<p>Rabbit polyclonal ZNF699 antibody</p>

<p>CYP24A1 antibody was raised in rabbit using the C terminal of CYP24A1 as the immunogen</p>

<p>Purified recombinant CNN2 protein (His tag)</p>

<p>GZMM antibody was raised in Rabbit using Human GZMM as the immunogen</p>

<p>PAR4 antibody was raised in rabbit using human par-4 protein# as the immunogen.</p>

<p>Mouse monoclonal Mature Macrophage Marker antibody</p>

<p>GMFG antibody was raised in Rabbit using Human GMFG as the immunogen</p>

<p>Purified Polyclonal AKR1CL2 antibody</p>

<p>Rabbit polyclonal IkB alpha antibody (Tyr305)</p>

<p>NAT15 antibody was raised using a synthetic peptide corresponding to a region with amino acids DYIQHLGSALASLSPCSIPHRVYRQAHSLLCSFLPWSGISSKSGIEYSRT</p>

<p>Rabbit polyclonal Chl16 antibody</p>

<p>Borrelia burgdorferi antibody was raised in rabbit using a whole cell preparation from Borrelia burgdorferi as the immunogen.</p>

<p>CANX antibody was raised in Rabbit using Human CANX as the immunogen</p>

<p>CCDC153 antibody was raised in Rabbit using Human CCDC153 as the immunogen</p>

<p>Rabbit polyclonal LN28A antibody</p>

<p>Troponin I antibody (cardiac) was raised in mouse using amino acid residues 18-28 of cTnI as the immunogen.</p>

<p>OTUD6B antibody was raised using the middle region of OTUD6B corresponding to a region with amino acids EIIQADSPPIIVGEEYSKKPLILVYMRHAYGLGEHYNSVTRLVNIVTENC</p>

<p>Rat monoclonal Ly49G2 antibody (FITC)</p>

<p>CARD6 antibody was raised in Rabbit using Human CARD6 as the immunogen</p>

<p>Cytokeratin 16 antibody was raised using a synthetic peptide corresponding to a region with amino acids IAATIENAQPILQIDNARLAADDFRTKYEHELALRQTVEADVNGLRRVLD</p>

<p>Rabbit polyclonal RAP2A antibody</p>

<p>HSPA1L antibody was raised in Rabbit using Human HSPA1L as the immunogen</p>

<p>Influence B nucleoprotein is a chemokine that serves as a diagnostic agent in the field of Life Sciences. It interacts with sorafenib, a protein-coupled receptor, and antibodies to facilitate various biological processes. This recombinant protein plays a crucial role in the growth factor signaling pathway and is reactive towards aliphatic hydrocarbons. It has been found to be associated with interleukin-6 and mycoplasma genitalium. With its diverse functions, Influence B nucleoprotein holds great potential for research and diagnostic applications in the field of Proteins and Antigens.</p>

<p>The S6K1 antibody is a highly effective inhibitor that specifically targets the S6 kinase 1 (S6K1) protein. This antibody is widely used in various research fields, including life sciences and molecular biology. It has been shown to effectively neutralize the activity of S6K1, which plays a crucial role in cell growth and proliferation.</p>

<p>Recombinant Human MAOA protein (His tag)</p>

<p>Purified recombinant POLR2F protein (His tag)</p>

<p>Mouse monoclonal RASD2 antibody</p>

<p>LOC652559 antibody was raised using the middle region of Loc652559 corresponding to a region with amino acids EKSKLGEVDHTLDLVVSFIQEQIVTEEAKSKNSGDAGVDRSLRGPYLARL</p>

<p>The Caspase 7 antibody is a highly specific and sensitive tool for detecting the activated form of caspase 7, an enzyme involved in programmed cell death. This antibody recognizes the tyrosine residue at position 198 of the activated caspase 7 protein. It has been extensively validated in various research applications, including immunohistochemistry, Western blotting, and flow cytometry.</p>

<p>Purified Rabbit polyclonal CBLN4 antibody</p>

<p>PTDSS1 antibody was raised using the N terminal of PTDSS1 corresponding to a region with amino acids MASCVGSRTLSKDDVNYKMHFRMINEQQVEDITIDFFYRPHTITLLSFTI</p>

<p>HAUS8 antibody was raised in rabbit using the N terminal of HAUS8 as the immunogen</p>

<p>BRD7 antibody was raised in Rabbit using Human BRD7 as the immunogen</p>

<p>(2R,3S)-E1R is a chiral chemical compound used in advanced research and pharmaceutical development. It is synthesized through a series of stereochemical reactions to ensure precise enantiomeric purity. The compound is typically derived from complex organic synthesis involving enantioselective catalysts, ensuring that its specific 2R,3S configuration is maintained.</p>

<p>Rabbit polyclonal CHST13 antibody</p>

<p>Mouse monoclonal SNX9 antibody</p>

<p>XBP1 antibody was raised in mouse using recombinant X-Box Binding Protein 1</p>

<p>Purified recombinant EHF protein (His tag)</p>

<p>HCCS antibody was raised in Rabbit using Human HCCS as the immunogen</p>

<p>1-157 amino acids: MGSSHHHHHH SSGLVPRGSH MSGSLGRAAA ALLRWGRGAG GGGLWGPGVR AAGSGAGGGG SAEQLDALVK KDKVVVFLKG TPEQPQCGFS NAVVQILRLH GVRDYAAYNV LDDPELRQGI KDYSNWPTIP QVYLNGEFVG GCDILLQMHQ NGDLVEELKK LGIHSALLDE KKDQDSK</p>

<p>Armenian Hamster monoclonal CD103 antibody (allophycocyanin)</p>

<p>SPIC antibody was raised in rabbit using the N terminal of SPIC as the immunogen</p>

<p>Mouse monoclonal EXD1 antibody</p>

<p>Na, Ca Exchanger antibody was raised in mouse using purified canine cardiac Na/Ca exchanger as the immunogen.</p>

<p>REEP1 antibody was raised using the C terminal of REEP1 corresponding to a region with amino acids ERLRSFSMQDLTTIRGDGAPAPSGPPPPGSGRASGKHGQPKMSRSASESA</p>

<p>GABARAPL1 antibody was raised using a synthetic peptide corresponding to a region with amino acids MKFQYKEDHPFEYRKKEGEKIRKKYPDRVPVIVEKAPKARVPDLDKRKYL</p>

<p>ZNF529 antibody was raised in rabbit using the N terminal of ZNF529 as the immunogen</p>

<p>HMG20B antibody was raised in Rabbit using Human HMG20B as the immunogen</p>

<p>Rabbit polyclonal B4GALNT1 antibody</p>

<p>SLC25A25 antibody was raised using a synthetic peptide corresponding to a region with amino acids MLQMLWHFLASFFPRAGCHGSREGDDREVRGTPAPAWRDQMASFLGKQDG</p>

<p>Rabbit polyclonal USP49 antibody</p>

<p>BTBD15 antibody was raised in rabbit using the C terminal of BTBD15 as the immunogen</p>

<p>Rat monoclonal CD150 antibody (allophycocyanin)</p>

<p>Tramadol Conjugate for use in immunoassays</p>

<p>GRO antibody was raised in rabbit using highly pure recombinant rat GRO/KC as the immunogen.</p>

<p>Factor B antibody was raised in Mouse using purified factor B from human blood as the immunogen.</p>

<p>Rabbit polyclonal PUB16 antibody</p>

<p>CBFB antibody was raised in Rabbit using Human CBFB as the immunogen</p>

<p>The ORC2 antibody is a powerful tool used in Life Sciences research. It specifically targets the antigen associated with serotonin, which plays a crucial role in various physiological processes. This antibody can be used as a serum marker to detect the presence of autoantibodies or as a molecular marker to study the expression and localization of ORC2 in cells and tissues.</p>

<p>GPSM2 antibody was raised using a synthetic peptide corresponding to a region with amino acids YFYLHDYAKALEYHHHDLTLARTIGDQLGEAKASGNLGNTLKVLGNFDEA</p>

<p>The Myoglobin antibody is an activated monoclonal antibody that belongs to the category of Life Sciences products. It is specifically designed to target and bind to myoglobin, a protein found in human serum. This antibody is highly specific and exhibits strong binding affinity towards myoglobin, making it an effective tool for various applications in research and diagnostics.</p>

<p>ZNF300 antibody was raised in rabbit using the N terminal of ZNF300 as the immunogen</p>

<p>DGCR8 antibody was raised using the N terminal of DGCR8 corresponding to a region with amino acids DKKDEENELDQEKRVEYAVLDELEDFTDNLELDEEGAGGFTAKAIVQRDR</p>

<p>PRKCB1 antibody was raised using the N terminal of PRKCB1 corresponding to a region with amino acids MADPAAGPPPSEGEESTVRFARKGALRQKNVHEVKNHKFTARFFKQPTFC</p>

<p>The PZP antibody is a monoclonal antibody that targets taxol and oncostatin, which are growth factors involved in various biological processes. This antibody specifically binds to the CD33 antigen, making it an effective tool for research and therapeutic applications. Monoclonal antibodies like the PZP antibody are widely used in the field of life sciences for their ability to selectively target and inhibit specific molecules or pathways. The PZP antibody can be used in hybridization experiments, as well as in the development of inhibitors or activators for CD33-related signaling pathways. It is a valuable tool for researchers studying annexin or collagen-related processes. Whether you're conducting basic research or developing new therapies, the PZP antibody is an essential component in your scientific toolkit.</p>

<p>The Daxx antibody is a highly specialized medicament used in Life Sciences. It is an antibody that specifically targets and neutralizes the epidermal growth factor (EGF). This antibody has been shown to inhibit the glycosylation process of EGF, preventing its activation and subsequent signaling pathways. Additionally, the Daxx antibody has a neutralizing effect on E-cadherin, which plays a crucial role in cell adhesion.</p>

<p>Rabbit polyclonal RAB10 antibody</p>

<p>1-527 amino acids: MGSSHHHHHH SSGLVPRGSH MGKRQHQKDK MYITCAEYTH FYGGKKPDLP QTNFRRLPFD HCSLSLQPFV YPVCTPDGIV FDLLNIVPWL KKYGTNPSNG EKLDGRSLIK LNFSKNSEGK YHCPVLFTVF TNNTHIVAVR TTGNVYAYEA VEQLNIKAKN FRDLLTDEPF SRQDIITLQD PTNLDKFNVS NFYHVKNNMK IIDPDEEKAK QDPSYYLKNT NAETRETLQE LYKEFKGDEI LAATMKAPEK KKVDKLNAAH YSTGKVSASF TSTAMVPETT HEAAAIDEDV LRYQFVKKKG YVRLHTNKGD LNLELHCDLT PKTCENFIRL CKKHYYDGTI FHRSIRNFVI QGGDPTGTGT GGESYWGKPF KDEFRPNLSH TGRGILSMAN SGPNSNRSQF FITFRSCAYL DKKHTIFGRV VGGFDVLTAM ENVESDPKTD RPKEEIRIDA TTVFVDPYEE ADAQIAQERK TQLKVAPETK VKSSQPQAGS QGPQTFRQGV GKYINPAATE QQRKSPQPVP LSPCPRRSPV GVLGTSAPGS SRLPDDH</p>

<p>The VCAM1 antibody is a monoclonal antibody that specifically targets the VCAM1 protein. This protein plays a crucial role in various biological processes, including cell adhesion and migration. The VCAM1 antibody has been extensively studied in the field of life sciences and has shown promising results in research related to cancer, inflammation, and immune response.</p>

<p>The SENP1 antibody is a highly specific monoclonal antibody used in Life Sciences research. It targets the protein SUMO-specific protease 1 (SENP1), which plays a crucial role in the regulation of various cellular processes. This antibody has been extensively validated and is known for its high specificity and sensitivity.</p>

<p>Eotaxin antibody was raised in mouse using highly pure recombinant human eotaxin as the immunogen.</p>

<p>The Agrin antibody is a highly specialized monoclonal antibody that targets the Agrin protein. This protein is found in human serum and plays a crucial role in various cellular processes, including colony-stimulating and actin filament formation. The Agrin antibody has been extensively tested and proven to have neutralizing effects on the Agrin protein, effectively blocking its activity. One of the key features of the Agrin antibody is its ability to specifically bind to the Agrin protein, preventing it from interacting with its receptors. This targeted binding ensures that the toxic effects of excessive Agrin activity are minimized. Additionally, the Agrin antibody has shown promising results in inhibiting the growth and migration of cells that rely on Agrin signaling for their function. In addition to its neutralizing properties, the Agrin antibody has also been used as a research tool in various studies involving cell biology and molecular biology. It has been utilized in experiments investigating the role of Agrin in different biological processes, such as embryonic development</p>

<p>UNC84A antibody was raised using a synthetic peptide corresponding to a region with amino acids QDAVTRRPPVLDESWIREQTTVDHFWGLDDDGDLKGGNKAAIQGNGDVGA</p>

<p>C7orf10 antibody was raised in Rabbit using Human C7orf10 as the immunogen</p>

<p>KEAP1 antibody was raised in Rabbit using Human KEAP1 as the immunogen</p>

<p>ZBTB40 antibody was raised in rabbit using the N terminal of ZBTB40 as the immunogen</p>

<p>BACE1 antibody was raised in Rabbit using Human BACE1 as the immunogen</p>

<p>Rabbit polyclonal MRPS12 antibody</p>

<p>GOLGA1 antibody was raised in Rabbit using Human GOLGA1 as the immunogen</p>

<p>The p90RSK antibody is a monoclonal antibody that is used in Life Sciences research. It is specifically designed to inhibit the activity of p90RSK, a family of serine/threonine kinases. This antibody has been shown to have therapeutic potential in various conditions, including thrombocytopenia and mesenchymal stem cell disorders. By targeting p90RSK, this antibody can modulate the growth factor signaling pathways and regulate cellular processes such as proliferation, differentiation, and apoptosis. Additionally, the p90RSK antibody has been found to interact with chemokines and interleukin-6, further highlighting its potential as a valuable tool in immunological research. With its high specificity and affinity for its target, this antibody offers researchers a reliable tool for studying the role of p90RSK in various biological processes.</p>

<p>Goat anti-mouse IgG (H+L) (Fab'2) was raised in goat using murine IgG whole molecule as the immunogen.</p>