Biochemicals and Reagents

<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the category of rifamycins. It is highly effective in treating tuberculosis infections due to its bactericidal activity. This compound works by binding to DNA-dependent RNA polymerase, preventing transcription and replication, thus inhibiting bacterial growth. Its potency has been confirmed through extensive studies using the patch-clamp technique on human erythrocytes. Additionally, it undergoes various metabolic transformations such as hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Furthermore, it specifically targets markers expressed at high levels in Mycobacterium tuberculosis strains and hinders cell growth in culture.</p>

<p>Mouse monoclonal CBR3 antibody</p>

<p>Goat anti-mouse IgG antibody was raised in goat using murine IgG as the immunogen.</p>

<p>LDLRAD1 antibody was raised in Rabbit using Human LDLRAD1 as the immunogen</p>

<p>Rabbit Polyclonal CNTROB antibody</p>

<p>Guinea pig RBC antibody (FITC) was raised in rabbit using guinea pig erythrocytes as the immunogen.</p>

<p>Purified Polyclonal CDKL4 antibody</p>

<p>IL2RG protein is a crucial component of the immune system and plays a vital role in T-cell development and function. It is targeted by autoantibodies, which can lead to autoimmune disorders. IL2RG protein is commonly used in Life Sciences research for various applications, including studying immune responses and developing therapeutic strategies. This protein can be conjugated with different molecules such as monoclonal antibodies or fluorophores for specific detection or imaging purposes. IL2RG protein exhibits excellent photostability, making it ideal for fluorescence-based assays. Additionally, it has been shown to have neutralizing effects on growth hormone receptor signaling and may have potential therapeutic implications in conditions associated with abnormal growth hormone activity. The colloidal form of IL2RG protein ensures optimal stability during storage and transportation, enabling reliable experimental results.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of ZNF567 antibody, catalog no. 70R-8432</p>

<p>Rabbit polyclonal PUM2 antibody</p>

<p>The ZNF8 antibody is a monoclonal antibody that specifically targets and inhibits the activity of Zinc finger protein 8 (ZNF8). This protein plays a crucial role in regulating adipose tissue development and function. By blocking the action of ZNF8, the antibody can effectively inhibit the differentiation and maturation of adipocytes, which are responsible for storing fat in the body.</p>

<p>Purified Polyclonal ATP6 antibody</p>

<p>The HP antibody is a specific monoclonal antibody that targets endothelial growth factor receptors. It has been extensively studied in the field of Life Sciences and has shown promising results in inhibiting the growth of various cancer cells, including MCF-7 breast cancer cells. The HP antibody works by binding to the protein kinase receptors on the surface of cancer cells and blocking their activation, thereby preventing cell proliferation and tumor growth. Additionally, this antibody has been found to reduce microvessel density, which is essential for tumor angiogenesis. Its therapeutic potential lies in its ability to specifically target and neutralize autoantibodies that promote tumor growth. The HP antibody can be used as a valuable tool in research and development of novel inhibitors for cancer treatment.</p>

<p>KCNS2 antibody was raised in Rabbit using Human KCNS2 as the immunogen</p>

<p>The SND1 antibody is a powerful tool in the field of Life Sciences. It is an insulin antibody that specifically targets and binds to insulin, a critical hormone involved in regulating blood sugar levels. This antibody can be used to detect and measure the presence of insulin in various biological samples, such as human serum.</p>

<p>Mouse monoclonal ZFAND2B antibody</p>

<p>Purified Polyclonal CHRNA1 antibody</p>

<p>Lamin antibody was raised in mouse using Nuclear pore complex-lamina fraction of Xenopus laevis (XLKE-A6 cells) as the immunogen.</p>

<p>Sheep polyclonal 17b Estradiol 6 antibody</p>

<p>Rat monoclonal CD150 antibody (biotin)</p>

<p>The CD27 antibody is a neutralizing monoclonal antibody that targets the CD27 protein. CD27 is a cell surface receptor that plays a crucial role in immune responses and lymphocyte activation. This antibody binds to CD27, preventing its interaction with other molecules and inhibiting downstream signaling pathways. It has been shown to inhibit the activity of glutamate phosphatase and block the production of autoantibodies. The CD27 antibody can be used in various research applications in the field of life sciences, including immunology and cell biology. It is commonly used in experiments involving activated lymphocytes, as well as in studies investigating cytotoxicity and growth factors. This high-quality monoclonal antibody is produced using advanced techniques and has been extensively tested for specificity and functionality. Its purity and reliability make it an excellent choice for researchers seeking accurate and reproducible results.</p>

<p>Mouse monoclonal CD34 antibody (PE)</p>

<p>GTF3C2 antibody was raised in mouse using recombinant Human General Transcription Factor Iiic, Polypeptide 2, Beta 110Kda (Gtf3C2)</p>

<p>Rabbit polyclonal KIAA0802 antibody</p>

<p>The GS28 antibody is a highly specialized protein that plays a crucial role in various biological processes. It is an autoantibody that can be used as both polyclonal and monoclonal antibodies for research purposes in the field of Life Sciences.</p>

<p>The Cytokeratin 8 antibody is a highly specialized monoclonal antibody that targets the activated form of Cytokeratin 8, a protein involved in cell growth and differentiation. This antibody has been extensively tested and proven to be reactive against Cytokeratin 8 in various research applications. It can be used for immunoassays, immunohistochemistry, and other life science experiments.</p>

<p>Mouse monoclonal pan Endothelium antibody</p>

<p>Rabbit polyclonal UBN2 antibody</p>

<p>Purified Polyclonal COL6A2 antibody</p>

<p>MINK1 antibody was raised in rabbit using the middle region of MINK1 as the immunogen</p>

<p>Hexokinase 2 antibody was raised using the N terminal of HK2 corresponding to a region with amino acids GTEHGEFLALDLGGTNFRVLWVKVTDNGLQKVEMENQIYAIPEDIMRGSG</p>

<p>Influenza A antibody was raised in mouse using nucleoproein of influenze A virus as the immunogen.</p>

<p>GTSE1 antibody was raised using the N terminal of GTSE1 corresponding to a region with amino acids NNPVPEQPPLPTSESPFAWSPLAGEKFVEVYKEAHLLALHIESSSRNQAA</p>

<p>Rabbit polyclonal SLC12A2 antibody</p>

<p>Purified recombinant MCTS1 protein (His tag)</p>

<p>The PDPK1 antibody is a highly specialized human antibody that plays a crucial role in the field of Life Sciences. It belongs to the category of costimulatory molecules and acts as a kinase inhibitor. This antibody has the unique ability to inhibit the activity of certain kinases, which are essential for cell signaling and regulation. By inhibiting these kinases, the PDPK1 antibody can effectively modulate various cellular processes.</p>

<p>METAP1 antibody was raised using the N terminal of METAP1 corresponding to a region with amino acids GDINTDPWAGYRYTGKLRPHYPLMPTRPVPSYIQRPDYADHPLGMSESEQ</p>

<p>Mouse monoclonal SD IpaA antibody</p>

<p>The IRAK1 antibody is a highly specialized and potent tool used in the field of Life Sciences. This antibody specifically targets the Interleukin-1 receptor-associated kinase 1 (IRAK1), which is an essential protein involved in various cellular processes such as immune response, cell growth, and apoptosis. By binding to IRAK1, this antibody effectively neutralizes its activated form and prevents its cytotoxic effects.</p>

<p>TMEM161B antibody was raised using the N terminal of TMEM161B corresponding to a region with amino acids GSLRWYQHPTEEELRILAGKQQKGKTKKDRKYNGHIESKPLTIPKDIDLH</p>

<p>Rabbit polyclonal UCK2 antibody</p>

<p>USP22 antibody was raised using the middle region of USP22 corresponding to a region with amino acids PSSCLVCEMSSLFQEFYSGHRSPHIPYKLLHLVWTHARHLAGYEQQDAHE</p>

<p>ZNF423 antibody was raised in rabbit using the middle region of ZNF423 as the immunogen</p>

<p>C1ORF25 antibody was raised in rabbit using the N terminal of C1ORF25 as the immunogen</p>

<p>Rat monoclonal TER119 antibody (FITC)</p>

<p>Rabbit polyclonal TRIM41 antibody</p>

<p>Mouse monoclonal CD325 antibody (biotin)</p>

<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the class of rifamycins. Specifically designed to combat tuberculosis infection, this compound exhibits strong bactericidal activity. It works by inhibiting bacterial growth through its binding to DNA-dependent RNA polymerase, effectively preventing transcription and replication. Extensive research has shown its high efficacy in human erythrocytes using a patch-clamp technique.</p>

<p>Mouse monoclonal SSR1 antibody</p>

<p>The VIM antibody is a monoclonal antibody that targets the interleukin-6 (IL-6) chemokine. It specifically binds to galectin-3-binding protein (LGALS3BP), which plays a crucial role in various biological processes, including cell growth and proliferation. The VIM antibody can be used in research applications to study protein-protein interactions and investigate the function of LGALS3BP in different cellular pathways.</p>

<p>Phentolamine is an adrenergic antagonist and is a tertiary amine. It binds to the alpha-adrenergic receptor and blocks the effects of norepinephrine, which is a neurotransmitter. Phentolamine has been used as a research tool for studying protein interactions and as an inhibitor for ion channels and receptors. In addition, it has been used in cell biology to study the effects of receptor activation on cell function.</p>

<p>Theophylline Conjugate for use in immunoassays</p>

<p>ZDHHC17 antibody was raised using the middle region of ZDHHC17 corresponding to a region with amino acids FLVIWLVGFIADLNIDSWLIKGLMYGGVWATVQFLSKSFFDHSMHSALPL</p>

<p>Mouse monoclonal FCN2 antibody</p>

<p>BHMT antibody was raised in mouse using recombinant human BHMT (1-406aa) purified from E. coli as the immunogen.</p>

<p>Mouse monoclonal DCXR antibody</p>

<p>DUSP12 antibody was raised in rabbit using the N terminal of DUSP12 as the immunogen</p>

<p>The CD43 antibody is a highly specialized monoclonal antibody that is widely used in the field of Life Sciences. It specifically targets and binds to CD43, a glycoprotein found on the surface of various cells. This antibody has been extensively studied and proven to be effective in various applications.</p>

<p>The GPR110 antibody is a highly specific monoclonal antibody that targets the GPR110 receptor, an activated hormone peptide receptor. This antibody has been extensively tested and validated for use in various applications, including bioassays and life sciences research.</p>

<p>Recombinant Human AGRP protein (His tag)</p>

<p>SLC26A5 antibody was raised using a synthetic peptide corresponding to a region with amino acids FSVTISMAKTLANKHGYQVDGNQELIALGLCNSIGSLFQTFSISCSLSRS</p>

<p>Armenian Hamster monoclonal DR5 antibody (PE)</p>

<p>Frizzled antibody was raised in rabbit using a synthetic peptide conjugated to KLH as the immunogen.</p>

<p>The CENPH antibody is a powerful tool used in various life sciences applications. It has the ability to neutralize tumor necrosis factor-alpha (TNF-α), which plays a crucial role in inflammation and immune response. This monoclonal antibody specifically targets CENPH, a protein involved in cell division and chromosome segregation. By binding to CENPH, the antibody prevents its interaction with other proteins, leading to impaired cell division and ultimately cell death.</p>

<p>CHAF1B antibody was raised using a synthetic peptide corresponding to a region with amino acids PPSSVPTSVISTPSTEEIQSETPGDAQGSPPELKRPRLDENKGGTESLDP</p>

<p>Mouse monoclonal NUDT18 antibody</p>

<p>Rat monoclonal CD244.2 antibody</p>

<p>CCNJ antibody was raised in mouse using recombinant Human Cyclin J (Ccnj)</p>

<p>This antibody reacts with heavy chains on human IgA + IgG + IgM and light chains on all human immunoglobulins.</p>

<p>CHAF1B antibody was raised using a synthetic peptide corresponding to a region with amino acids KVITCEIAWHNKEPVYSLDFQHGTAGRIHRLASAGVDTNVRIWKVEKGPD</p>

<p>The CDC42 antibody is a monoclonal antibody that has the ability to neutralize the influenza hemagglutinin. It belongs to the group of antibodies known as monoclonal antibodies, which are highly specific and targeted against a particular antigen. This antibody can be used in various applications, including diagnostic tests and research studies.</p>

<p>Rabbit polyclonal RAB2A antibody</p>

<p>Rabbit polyclonal SEMA4B antibody</p>

<p>Recombinant Human UBE2G1 protein</p>

<p>GINS2 antibody was raised using a synthetic peptide corresponding to a region with amino acids DAAEVEFLAEKELVTIIPNFSLDKIYLIGGDLGPFNPGLPVEVPLWLAIN</p>

<p>ITGB1BP1 antibody was raised in Rabbit using Human ITGB1BP1 as the immunogen</p>

<p>Purified Polyclonal SHPTP2 antibody</p>

<p>Rabbit Polyclonal ARHGDIA antibody (Ser174)</p>

<p>ADA antibody was raised using the N terminal of ADA corresponding to a region with amino acids AIAGCREAIKRIAYEFVEMKAKEGVVYVEVRYSPHLLANSKVEPIPWNQA</p>

<p>BPIL1 antibody was raised in Rabbit using Human BPIL1 as the immunogen</p>

<p>LYK5 antibody was raised using the N terminal of LYK5 corresponding to a region with amino acids MSFLTNDASSESIASFSKQEVMSSFLPEGGCYELLTVIGKGFEDLMTVNL</p>

<p>Rabbit polyclonal ACC1 antibody</p>

<p>HTR1E antibody was raised in rabbit using a synthetic peptide conjugated to KLH as the immunogen.</p>

<p>Copine IV antibody was raised using the C terminal of CPNE4 corresponding to a region with amino acids EAYQSCLPKLQLYGPTNIAPIIQKVAKSASEETNTKEASQYFILLILTDG</p>

<p>Rabbit polyclonal STEAP3 antibody</p>

<p>ABI3BP antibody was raised using a synthetic peptide corresponding to a region with amino acids LINPHHDWTLPSHCPNDRFYTIRYREKDKEKKWIFQICPATETIVENLKP</p>

<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is an effective antituberculosis drug that falls under the class of rifamycins. It is known to be the most potent rifamycin for treating tuberculosis infections. By binding to DNA-dependent RNA polymerase, this drug inhibits bacterial growth and prevents transcription and replication. Extensive research has shown its high activity on human erythrocytes using a patch-clamp technique. The active form of this drug undergoes various metabolic transformations, including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, it specifically targets markers expressed in Mycobacterium tuberculosis strains and inhibits their cell growth in culture.</p>

<p>The GATA1 antibody is a highly specialized product in the field of Life Sciences. It belongs to the class of monoclonal antibodies and is designed to target specific virus surface antigens. This antibody has been extensively tested and proven to effectively inhibit the growth and replication of viruses in human serum.</p>

<p>SOX6 antibody was raised in mouse using recombinant Human Sry (Sex Determining Region Y)-Box 6 (Sox6),</p>

<p>Mouse monoclonal PNPO antibody</p>

<p>N-Omega-allyl-L-arginine is a synthetic peptide with inhibitory activity against protein interactions. It has been used as a research tool to study the activation of ion channels, receptor binding, and ligand binding. N-Omega-allyl-L-arginine is also an activator of the nitric oxide synthase enzyme. This product is a high purity, pharmaceutical grade product that can be used in life science research applications, including antibody production and cell biology.</p>

<p>MPST antibody was raised using the middle region of MPST corresponding to a region with amino acids DPAFIKTYEDIKENLESRRFQVVDSRATGRFRGTEPEPRDGIEPGHIPGT</p>

<p>OR1D2 antibody was raised in rabbit using the C terminal of OR1D2 as the immunogen</p>

<p>Rabbit polyclonal STMN3 antibody</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of VPREB1 antibody, catalog no. 70R-5905</p>

<p>ESRRG antibody was raised in rabbit using a synthetic peptide conjugated to KLH as the immunogen.</p>

<p>Sheep polyclonal 17b Testosterone antibody</p>

<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is an effective antituberculosis drug that falls under the class of rifamycins. It is specifically designed to target tuberculosis infections and contains active compounds with bactericidal activity. By binding to DNA-dependent RNA polymerase, it inhibits bacterial growth, preventing transcription and replication. This drug has been extensively studied using advanced techniques like the patch-clamp technique on human erythrocytes. Its active form undergoes various metabolic transformations, including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, it binds to markers expressed at high levels in Mycobacterium tuberculosis strains and inhibits cell growth in culture.</p>

<p>KLF6 antibody was raised in Rabbit using Human KLF6 as the immunogen</p>

<p>Mouse monoclonal SPINT1 antibody</p>