Biochemicals and Reagents
Biochemicals and reagents are fundamental substances for research and development in fields such as biotechnology, molecular biology, pharmacology, and medicine. These products are essential for a variety of applications, including compound synthesis, biological sample analysis, metabolic process research, and drug production. At CymitQuimica, we offer a wide selection of high-quality, high-purity biochemicals and reagents suitable for various scientific and industrial needs. Our catalog includes enzymes, antibodies, nucleic acids, amino acids, and many other products, all designed to support researchers and professionals in their research and development projects, ensuring reliable and reproducible results.
Subcategories of "Biochemicals and Reagents"
- Biomolecules(98,574 products)
- By Biological Target(100,743 products)
- By Pharmacological Effects(6,938 products)
- Cryopreservatives(21 products)
- Desinfectants and Related Compounds(28 products)
- Hormones(454 products)
- Plant Biology(6,906 products)
- Secondary Metabolites(14,368 products)
Found 130507 products of "Biochemicals and Reagents"
Sort by
Purity (%)
0
100
|
0
|
50
|
90
|
95
|
100
MAGEB3 antibody
MAGEB3 antibody was raised using the N terminal of MAGEB3 corresponding to a region with amino acids MPRGQKSTLHAREKRQQTRGQTQDHQGAQITATNKKKVSFSSPLILGATIGRM6 antibody
GRM6 antibody was raised in rabbit using the N terminal of GRM6 as the immunogen
Purity:Min. 95%HAL Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of HAL antibody, catalog no. 70R-1179Purity:Min. 95%Keratin K19 antibody
Keratin K19 antibody was raised in Guinea Pig using Acidic human keratin K18 as the immunogen.Purity:Min. 95%Shc1 antibody
The Shc1 antibody is a monoclonal antibody that specifically targets the epidermal growth factor (EGF) and its receptor. It has the ability to bind to EGF-like molecules and inhibit their activity. This antibody can also neutralize the effects of EGF by preventing its binding to receptors on cells. The Shc1 antibody is highly specific and has been extensively studied in various life science research applications. It is commonly used in experiments involving growth factors, hormones, peptides, chemokines, and other signaling molecules. Additionally, this antibody has been shown to interact with human serum albumin, a major protein found in blood plasma. Its unique characteristics make it a valuable tool for researchers in the field of molecular biology and biochemistry.Purity:Min. 95%SNAP25 protein
1-206 amino acids: MAEDADMRNE LEEMQRRADQ LADESLESTR RMLQLVEESK DAGIRTLVML DEQGEQLERI EEGMDQINKD MKEAEKNLTD LGKFCGLCVC PCNKLKSSDA YKKAWGNNQD GVVASQPARV VDEREQMAIS GGFIRRVTND ARENEMDENL EQVSGIIGNL RHMALDMGNE IDTQNRQIDR IMEKADSNKT RIDEANQRAT KMLGSGPurity:Min. 95%Sntg1 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of Sntg1 antibody, catalog no. 70R-9493Purity:Min. 95%Beta Tubulin 2A Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of TUBB2A antibody, catalog no. 70R-2909
Purity:Min. 95%ACADL Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of ACADL antibody, catalog no. 70R-2510
Purity:Min. 95%MN1 antibody
The MN1 antibody is a polyclonal antibody used in various applications within the Life Sciences field. It can be utilized for hybridization studies, electrophoresis, and neutralizing assays. This antibody has shown efficacy in inhibiting dopamine-induced agglutination and fibrinogen binding. Additionally, it has been found to have an impact on chemokine production in granulosa cells. The MN1 antibody is also commonly used for research involving erythropoietin, collagen, and interleukin-6. With its versatility and effectiveness, this antibody is a valuable tool for scientists conducting experiments in a wide range of disciplines within the Life Sciences field.SRD5A2 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of SRD5A2 antibody, catalog no. 70R-7329Purity:Min. 95%Podocin antibody
The Podocin antibody is a powerful tool in the field of Life Sciences. It is widely used in various applications such as lectins, hybridization, growth factor studies, and anti-VEGF research. This antibody specifically targets podocin, a protein that plays a crucial role in kidney function and maintenance of the glomerular filtration barrier.
KCTD19 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of KCTD19 antibody, catalog no. 70R-5057Purity:Min. 95%ING4 antibody
ING4 antibody was raised in rabbit using the middle region of ING4 as the immunogenPurity:Min. 95%Bovine IgM
Bovine IgM is a purified immunoglobulin that exhibits neutralizing properties. It is derived from bovine serum and is commonly used in the field of life sciences for various research purposes. Bovine IgM acts as an immunosuppressant by inhibiting the activation of immune cells, such as adipose tissue-derived mesenchymal stem cells. This monoclonal antibody specifically targets proteins involved in the PI3-kinase signaling pathway, including calmodulin. Additionally, Bovine IgM has been shown to modulate the production of interleukin-6, a cytokine involved in immune response regulation. Its reactive nature makes it a valuable tool for studying immune system functions and can be used in diagnostic assays or as a diuretic agent.Purity:Min. 95%GPR83 antibody
GPR83 antibody was raised in rabbit using the C terminal of GPR83 as the immunogenPurity:Min. 95%HDAC9 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of HDAC9 antibody, catalog no. 70R-5663Purity:Min. 95%PCOLCE Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of PCOLCE antibody, catalog no. 70R-5478Purity:Min. 95%EIF2A Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of EIF2A antibody, catalog no. 70R-1455Purity:Min. 95%Rabbit anti Mouse Kappa Chain (rhodamine)
Rabbit anti-mouse kappa chain (Rhodamine) was raised in rabbit using murine kappa light chain fragment as the immunogen.Purity:Min. 95%Protein A antibody (HRP)
Protein A antibody (HRP) was raised in goat using Protein A [Staphylococcus aureus] as the immunogen.Purity:Min. 95%Nestin Antibody
The Nestin Antibody is a highly reactive monoclonal antibody that specifically targets the glial fibrillary acidic protein (GFAP). It is widely used in life sciences research to study the activation and differentiation of neural stem cells. The Nestin Antibody recognizes peptide antigens present in activated neural progenitor cells, making it an essential tool for investigating their behavior and function. Additionally, this antibody has been shown to inhibit the effects of interleukin-6 (IL-6) and leukemia inhibitory factor (LIF), which are known to influence neural cell differentiation and survival. The Nestin Antibody is commonly used in immunohistochemistry and immunocytochemistry experiments, providing researchers with valuable insights into the development and regeneration of the nervous system.MARCKS antibody
The MARCKS antibody is a non-phosphorylated monoclonal antibody that targets the protein MARCKS (Myristoylated Alanine-Rich C Kinase Substrate). This antibody specifically recognizes the non-phosphorylated form of MARCKS and can be used in various life science applications.ELK1 antibody
ELK1 antibody was raised in Mouse using a purified recombinant fragment of ELK1 expressed in E. coli as the immunogen.FAIM Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of FAIM antibody, catalog no. 70R-3011Purity:Min. 95%ALDH7A1 antibody
ALDH7A1 antibody was raised using the N terminal of ALDH7A1 corresponding to a region with amino acids NQPQYAWLKELGLREENEGVYNGSWGGRGEVITTYCPANNEPIARVRQASRAB11FIP5 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of RAB11FIP5 antibody, catalog no. 70R-9316
Purity:Min. 95%ZNF90 antibody
ZNF90 antibody was raised in rabbit using the N terminal of ZNF90 as the immunogen
Purity:Min. 95%RBM12 antibody
RBM12 antibody was raised using the N terminal of RBM12 corresponding to a region with amino acids PPPSSGMSSRVNLPTTVSNFNNPSPSVVTATTSVHESNKNIQTFSTASVGIL10 antibody
IL10 antibody was raised in rabbit using highly pure recombinant human IL-10 as the immunogen.Capping Protein alpha 3 antibody
Capping Protein alpha 3 antibody was raised in Guinea Pig using synthetic N-terminal domain of mouse F-actin alpha 3 subunit coupled to KLH as the immunogen.
Purity:Min. 95%S100A3 antibody
S100A3 antibody was raised using the N terminal of S100A3 corresponding to a region with amino acids MARPLEQAVAAIVCTFQEYAGRCGDKYKLCQAELKELLQKELATWTPTEFCytokeratin 19 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of KRT19 antibody, catalog no. 70R-3035Purity:Min. 95%tPA antibody
tPA antibody was raised in sheep using human tissue-type plasminogen activator prepared from melanoma cell line as the immunogen.BRCA1 antibody
The BRCA1 antibody is a highly specialized monoclonal antibody that specifically targets the BRCA1 protein. This protein plays a crucial role in DNA repair and is associated with the development of breast and ovarian cancers. The BRCA1 antibody has been extensively studied and has shown cytotoxic effects on cancer cells by inhibiting the activity of protein kinases involved in cell proliferation. It binds to the nuclear compartment of cells, specifically targeting the BRCA1 protein, which leads to its degradation and prevents its function in repairing damaged DNA. This antibody has also been used in research to study other proteins, such as alpha-synuclein and collagen, and has shown potential as a therapeutic agent for various types of cancer. With its high specificity and ability to inhibit activated proteins, the BRCA1 antibody is a valuable tool for both diagnostic purposes and targeted therapies.GLS Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of GLS antibody, catalog no. 70R-5477
Purity:Min. 95%PSMF1 antibody
PSMF1 antibody was raised in rabbit using the middle region of PSMF1 as the immunogenPurity:Min. 95%RXRA antibody
RXRA antibody was raised using the N terminal of RXRA corresponding to a region with amino acids DTKHFLPLDFSTQVNSSLTSPTGRGSMAAPSLHPSLGPGIGSPGQLHSPIIL1 beta antibody
IL1 beta antibody is a highly effective and versatile antibody that targets the IL1 beta protein, a key player in the immune response and inflammation. This monoclonal antibody specifically binds to IL1 beta, neutralizing its activity and preventing its interaction with its receptor. By inhibiting IL1 beta, this antibody can effectively reduce inflammation and promote healing.Actin antibody
Actin antibody was raised in mouse using synthetic NH2 terminus decapeptide of cardiac isoform of actin as the immunogen.CD31 antibody
CD31 antibody was raised in Mouse using a purified recombinant fragment of human CD31 expressed in E. coli as the immunogen.PEX7 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of PEX7 antibody, catalog no. 70R-3689Purity:Min. 95%TSHR antibody
TSHR antibody was raised using the N terminal of TSHR corresponding to a region with amino acids CHQEEDFRVTCKDIQRIPSLPPSTQTLKLIETHLRTIPSHAFSNLPNISRRabbit anti Human IgM (HRP)
Rabbit anti-human IgM (HRP) was raised in rabbit using human IgM Fc5mu fragment as the immunogen.Purity:Min. 95%PDS5A antibody
PDS5A antibody was raised using a synthetic peptide corresponding to a region with amino acids PPAPSKPRRGRRPKSESQGNATKNDDLNKPINKGRKRAAVGQESPGGLEALRRC57 antibody
LRRC57 antibody was raised using the middle region of LRRC57 corresponding to a region with amino acids NNKLTVLPDEICNLKKLETLSLNNNHLRELPSTFGQLSALKTLSLSGNQL
DPY19L4 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of DPY19L4 antibody, catalog no. 70R-7039Purity:Min. 95%Keratin K3 antibody
Keratin K3 antibody was raised in Guinea Pig using synthetic peptide of human keratin K3 coupled to KLH as the immunogen.Purity:Min. 95%PSTPIP2 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of PSTPIP2 antibody, catalog no. 70R-10413Purity:Min. 95%Neuroplastin Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of NPTN antibody, catalog no. 70R-1874Purity:Min. 95%RAD51L1 antibody
RAD51L1 antibody was raised in rabbit using the middle region of RAD51L1 as the immunogen
Purity:Min. 95%HMOX2 protein
1-264 amino acids: MSAEVETSEG VDESEKKNSG ALEKENQMRM ADLSELLKEG TKEAHDRAEN TQFVKDFLKG NIKKELFKLA TTALYFTYSA LEEEMERNKD HPAFAPLYFP MELHRKEALT KDMEYFFGEN WEEQVQCPKA AQKYVERIHY IGQNEPELLV AHAYTRYMGD LSGGQVLKKV AQRALKLPST GEGTQFYLFE NVDNAQQFKQ LYRARMNALD LNMKTKERIV EEANKAFEYN MQIFNELDQA GSTLARETLE DGFPVHDGKG DMRKPurity:Min. 95%
