Biochemicals and Reagents
Biochemicals and reagents are fundamental substances for research and development in fields such as biotechnology, molecular biology, pharmacology, and medicine. These products are essential for a variety of applications, including compound synthesis, biological sample analysis, metabolic process research, and drug production. At CymitQuimica, we offer a wide selection of high-quality, high-purity biochemicals and reagents suitable for various scientific and industrial needs. Our catalog includes enzymes, antibodies, nucleic acids, amino acids, and many other products, all designed to support researchers and professionals in their research and development projects, ensuring reliable and reproducible results.
Subcategories of "Biochemicals and Reagents"
- Biomolecules(98,557 products)
- By Biological Target(100,795 products)
- By Pharmacological Effects(6,941 products)
- Cryopreservatives(21 products)
- Desinfectants and Related Compounds(28 products)
- Hormones(508 products)
- Plant Biology(6,904 products)
- Secondary Metabolites(14,368 products)
Found 130538 products of "Biochemicals and Reagents"
Sort by
Purity (%)
0
100
|
0
|
50
|
90
|
95
|
100
LIMK2 antibody
The LIMK2 antibody is a peptide agent that specifically binds to LIM kinase 2 (LIMK2), a protein involved in cellular processes such as cell migration, proliferation, and differentiation. This antibody can be used for various applications, including immunoprecipitation, western blotting, and immunofluorescence. It is produced using monoclonal antibody technology, ensuring high specificity and sensitivity. The LIMK2 antibody has been shown to neutralize the activity of LIMK2 and inhibit its downstream signaling pathways. Additionally, it can be used to study the glycosylation patterns of LIMK2 and its binding proteins. This antibody offers researchers a valuable tool for investigating the role of LIMK2 in various biological processes and may have potential therapeutic applications in diseases associated with abnormal LIMK2 activity.RXRA Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of RXRA antibody, catalog no. 70R-1938Purity:Min. 95%Egln2 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of EGLN2 antibody, catalog no. 70R-8402Purity:Min. 95%GFOD1 antibody
GFOD1 antibody was raised using the middle region of GFOD1 corresponding to a region with amino acids NSLLPEKAFSDIPSPYLRGTIKMMQAVRQAFQDQDDRRTWDGRPLTMAAT
IL10 protein
Region of IL10 protein corresponding to amino acids MSPGQGTQSE NSCTHFPGNL PNMLRDLRDA FSRVKTFFQM KDQLDNLLLK ESLLEDFKGY LGCQALSEMI QFYLEEVMPQ AENQDPDIKA HVNSLGENLK TLRLRLRRCH RFLPCENKSK AVEQVKNAFN KLQEKGIYKA MSEFDIFINY IEAYMTMKIR N.Purity:Min. 95%CD7 antibody
CD7 antibody was raised in rabbit using the middle region of CD7 as the immunogen
Purity:Min. 95%RHEB Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of RHEB antibody, catalog no. 70R-5794Purity:Min. 95%BNP antibody
The BNP antibody is a monoclonal antibody that specifically targets brain natriuretic peptide (BNP). It is designed for use in various applications, including immunoassays and research studies. This antibody has been shown to effectively detect BNP in human serum samples, making it a valuable tool for diagnostic purposes.ANKRD2 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of ANKRD2 antibody, catalog no. 70R-3378
Purity:Min. 95%GNB4 antibody
GNB4 antibody was raised in rabbit using the middle region of GNB1-4 as the immunogenPurity:Min. 95%ACTL7B Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of ACTL7B antibody, catalog no. 70R-2102
Purity:Min. 95%p100 Nuclear Coactivator Protein antibody
p100 Nuclear Coactivator Protein antibody was raised in Guinea Pig using synthetic duplicated C-terminus of human p100 protein conjugated to KLH as the immunogen.Purity:Min. 95%C17ORF81 antibody
C17ORF81 antibody was raised using the C terminal Of C17Orf81 corresponding to a region with amino acids FSILPDFSLDLQEGPSVESQPYSDPHIPPVSKNAKARTRKCSLVSGHGRE14.3.3 β protein
1-246 amino acids: MTMDKSELVQ KAKLAEQAER YDDMAAAMKA VTEQGHELSN EERNLLSVAY KNVVGARRSS WRVISSIEQK TERNEKKQQM GKEYREKIEA ELQDICNDVL ELLDKYLIPN ATQPESKVFY LKMKGDYFRY LSEVASGDNK QTTVSNSQQA YQEAFEISKK EMQPTHPIRL GLALNFSVFY YEILNSPEKA CSLAKTAFDE AIAELDTLNE ESYKDSTLIM QLLRDNLTLW TSENQGDEGD AGEGENTmco3 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of Tmco3 antibody, catalog no. 70R-8681Purity:Min. 95%TMEM107 antibody
TMEM107 antibody was raised in rabbit using the N terminal of TMEM107 as the immunogenPurity:Min. 95%PPP5C Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of CXCR6 antibody, catalog no. 70R-10500Purity:Min. 95%FAM98B antibody
FAM98B antibody was raised using the N terminal of FAM98B corresponding to a region with amino acids LTKAAEGGLSSPEFSELCIWLGSQIKSLCNLEESITSAGRDDLESFQLEI
TERF2IP antibody
TERF2IP antibody was raised using the middle region of TERF2IP corresponding to a region with amino acids EDPEAADSGEPQNKRTPDLPEEEYVKEEIQENEEAVKKMLVEATREFEEV
Dusp19 antibody
Dusp19 antibody was raised in rabbit using the N terminal of Dusp19 as the immunogenPurity:Min. 95%HDAC9 antibody
HDAC9 antibody was raised using the C terminal of HDAC9 corresponding to a region with amino acids QVGAVKVKEEPVDSDEDAQIQEMESGEQAAFMQQVIGKDLAPGFVIKVIIEXOSC6 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of EXOSC6 antibody, catalog no. 70R-4889Purity:Min. 95%QTRT1 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of QTRT1 antibody, catalog no. 70R-2965Purity:Min. 95%Aggrecan antibody
The Aggrecan antibody is a growth factor that belongs to the class of antibodies. It is a monoclonal antibody with low density and globulin inhibitors. This antibody specifically targets hyaluronic acid, epidermal growth factor, antigens, interferons, and fatty acids. The Aggrecan antibody is widely used in the field of life sciences and has been shown to have neutralizing effects on its target molecules. Its high specificity and efficacy make it an essential tool for researchers in various scientific disciplines.
BRD3 antibody
The BRD3 antibody is a highly specialized antibody preparation that has various applications in the field of life sciences. It is commonly used in research involving pluripotent stem cells, antimicrobial peptides, and interleukin-6. This antibody has been shown to induce apoptosis and neutralize certain growth factors, making it an essential tool for studying cellular processes and signaling pathways. The BRD3 antibody can be used in techniques such as transcription-polymerase chain reaction (PCR) and mitogen-activated protein assays. It is available both as polyclonal antibodies and monoclonal antibodies, providing researchers with options based on their specific needs. Additionally, this antibody can be used in conjunction with AMPK activators and colony-stimulating factors to further enhance its effects. With its versatility and reliability, the BRD3 antibody is an invaluable asset for scientists conducting cutting-edge research in various fields of study within the life sciences domain.PRKCZ Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of PRKCZ antibody, catalog no. 70R-2654Purity:Min. 95%SUB1 protein (His tag)
1-127 amino acids: MGSSHHHHHH SSGLVPRGSH MPKSKELVSS SSSGSDSDSE VDKKLKRKKQ VAPEKPVKKQ KTGETSRALS SSKQSSSSRD DNMFQIGKMR YVSVRDFKGK VLIDIREYWM DPEGEMKPGR KGISLNPEQW SQLKEQISDI DDAVRKLPurity:Min. 95%PGBD2 antibody
PGBD2 antibody was raised using the middle region of PGBD2 corresponding to a region with amino acids RICCQDAQVDLLAFRRYIACVYLESNADTTSQGRRSRRLETESRFDMIGH
TSG101 antibody
TSG101 antibody was raised in rabbit using the middle region of TSG101 as the immunogenPurity:Min. 95%TNRC18 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of TNRC18 antibody, catalog no. 70R-9120Purity:Min. 95%CDC2 antibody
The CDC2 antibody is a highly specialized antibody that has multiple applications in the field of biomedical research. It is a polyclonal antibody that can be used for various purposes, such as immunohistochemistry and Western blotting. The CDC2 antibody specifically targets the CDC2 protein, which plays a crucial role in cell division and proliferation.Purity:Min. 95%PLA2G2E antibody
PLA2G2E antibody was raised in rabbit using the middle region of PLA2G2E as the immunogenPurity:Min. 95%IER5L antibody
IER5L antibody was raised using the middle region of IER5L corresponding to a region with amino acids SNLISIFGSGFSGLVSRQPDSSEQPPPLNGQLCAKQALASLGAWTRAIVA
PDIA6 antibody
The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the class of rifamycins. It is specifically designed to combat tuberculosis infections by targeting the active compounds responsible for bactericidal activity. This drug works by binding to DNA-dependent RNA polymerase, effectively preventing transcription and replication, thus inhibiting bacterial growth. Extensive studies have shown its high efficacy through various techniques such as transcription-quantitative polymerase chain and patch-clamp technique. Additionally, it undergoes several metabolic transformations, making it highly versatile in combating mycobacterium infections. With its ability to specifically bind to markers expressed in Mycobacterium tuberculosis strains, this drug effectively inhibits cell growth in culture.ST5 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of ST5 antibody, catalog no. 70R-10055Purity:Min. 95%ATP6AP1 antibody
ATP6AP1 antibody was raised using the middle region of ATP6AP1 corresponding to a region with amino acids SPVIHPPVSYNDTAPRILFWAQNFSVAYKDQWEDLTPLTFGVQELNLTGSCSHL1 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of CSHL1 antibody, catalog no. 70R-6216
Purity:Min. 95%RGS20 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of RGS20 antibody, catalog no. 70R-1143Purity:Min. 95%CD3e antibody (Azide Free)
CD3e antibody (Azide free) was raised in hamster using H-2Kb-specific murine cytotoxic T lymphocyte as the immunogen.
ERBB3 antibody
ERBB3 antibody was raised in Mouse using a purified recombinant fragment of ERBB3(aa1175-1275) expressed in E. coli as the immunogen.
ENSA Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of ENSA antibody, catalog no. 70R-4510Purity:Min. 95%NT5M Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of NT5M antibody, catalog no. 70R-2441Purity:Min. 95%CHK2 antibody
The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the class of rifamycins. It is specifically designed to combat tuberculosis infection by targeting active compounds and exhibiting bactericidal activity. This drug works by binding to DNA-dependent RNA polymerase, preventing transcription and replication, thus inhibiting bacterial growth. Its effectiveness has been demonstrated through extensive research using the patch-clamp technique on human erythrocytes. Additionally, it undergoes various metabolic transformations, including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Notably, 6-Fluoro-3-indoxyl-beta-D-galactopyranoside specifically binds to markers expressed at high levels in Mycobacterium tuberculosis strains and hinders cell growth in culture.SRF antibody
The SRF antibody is a powerful tool in biomedical research and diagnostics. It is an antibody that specifically targets the growth factor known as SRF (Serum Response Factor). This growth factor plays a crucial role in cell proliferation, differentiation, and survival. The SRF antibody can be used to study the function of SRF in various biological processes, including development, tissue repair, and disease progression.PTK2B antibody
PTK2B antibody was raised using the C terminal of PTK2B corresponding to a region with amino acids QKQMVEDYQWLRQEEKSLDPMVYMNDKSPLTPEKEVGYLEFTGPPQKPPREEF1B2 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of EEF1B2 antibody, catalog no. 70R-2143Purity:Min. 95%CACHD1 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of CACHD1 antibody, catalog no. 70R-6902
Purity:Min. 95%Goat anti Human IgG (Fab'2) (FITC)
Goat anti-human IgG (Fab'2) (FITC) was raised in goat using human IgG F(ab')2 fragment as the immunogen.Purity:Min. 95%Osteocalcin antibody
The Osteocalcin antibody is a highly specialized antibody that targets osteopontin, a basic protein involved in bone formation and remodeling. This monoclonal antibody can be used in various research applications within the Life Sciences field. It specifically binds to osteopontin and can be utilized for experiments such as immunohistochemistry, western blotting, and enzyme-linked immunosorbent assays (ELISA). The Osteocalcin antibody has also been shown to exhibit cross-reactivity with other proteins such as serum albumin, E-cadherin, β-catenin, taxol, oncostatin, and angptl3. Its high specificity and sensitivity make it an invaluable tool for studying bone biology and related diseases.PDK1 antibody
The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is an antituberculosis drug that falls under the class of rifamycins. It is known to be the most effective rifamycin in treating tuberculosis infections. This drug works by inhibiting bacterial growth through its binding to DNA-dependent RNA polymerase, preventing transcription and replication. Its high activity has been demonstrated using a patch-clamp technique on human erythrocytes. The active form of this drug undergoes various metabolic transformations, including hydrolysis, oxidation, reduction, or conjugation with glucuronic acid. Additionally, it specifically binds to markers expressed in Mycobacterium tuberculosis strains and inhibits cell growth in culture.
PTPMT1 antibody
The PTPMT1 antibody is a highly specialized antibody used in the field of Life Sciences. It specifically targets and binds to the epidermal growth factor, making it an essential tool for research and diagnostic purposes. This antibody is available in both monoclonal and polyclonal forms, allowing researchers to choose the best option for their specific needs.GLUT2 antibody
The GLUT2 antibody is a growth factor that has been activated and neutralized to provide effective results. It has been tested in human serum and has shown promising results in inhibiting the activity of alpha-fetoprotein, a protein associated with certain cancers. Additionally, this antibody has demonstrated the ability to block chemokine activity, which plays a role in inflammation and immune response.
SNRPA1 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of SNRPA1 antibody, catalog no. 70R-4716
Purity:Min. 95%KCTD18 antibody
KCTD18 antibody was raised using the N terminal of KCTD18 corresponding to a region with amino acids LHYLNTSGASCESRIIGVYATKTDGTDAIEKQLGGRIHSKGIFKREAGNNC4ORF23 antibody
C4ORF23 antibody was raised using the N terminal Of C4Orf23 corresponding to a region with amino acids LTPWIPVIAARSSYNCRFFVLPCCFFDFIGRYSRRQSKKTQYREYLDFIKKLHL20 antibody
KLHL20 antibody was raised in rabbit using the C terminal of KLHL20 as the immunogenPurity:Min. 95%Thiabendazole antibody
Thiabendazole antibody is a versatile product used in the field of Life Sciences. It is an antibody that specifically targets and binds to thiabendazole, a compound commonly found in collagen and β-catenin. This antibody has been extensively studied for its anti-mesothelin properties, making it an important tool in cancer research. Additionally, it has cytotoxic effects on target molecules and has shown promising results in inhibiting urokinase plasminogen activator activity. Thiabendazole antibody is available as both polyclonal and monoclonal antibodies, providing researchers with options to suit their specific needs.Purity:Min. 95%IFRD1 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of IFRD1 antibody, catalog no. 70R-3682Purity:Min. 95%PLCG2 antibody
The PLCG2 antibody is a highly specialized antibody that targets the PLCG2 protein. This protein plays a crucial role in various cellular processes, including signal transduction and immune response. The antibody specifically recognizes and binds to the activated form of PLCG2, inhibiting its activity and preventing further downstream signaling.Purity:Min. 95%Fibroblast antibody
Fibroblast antibody was raised in mouse using whole human thymic stoma cells as the immunogen.
HER2 antibody
The HER2 antibody is a protein that belongs to the family of collagen antibodies. It is an anti-HER2 antibody that acts as a kinase inhibitor, targeting the epidermal growth factor receptor. This antibody is widely used in the field of Life Sciences for research purposes. It has been shown to inhibit the signaling pathways of HER2, which is involved in cell proliferation and survival. Additionally, the HER2 antibody has been found to have therapeutic potential in the treatment of various diseases, including breast cancer. It can be used in combination with other treatments, such as trastuzumab, a monoclonal antibody, to enhance their efficacy. The HER2 antibody can also be utilized in immunoassays and diagnostic tests due to its high specificity and sensitivity. Its diverse applications make it an essential tool for researchers and clinicians alike.Human Growth Hormone antibody
Human Growth Hormone antibody was raised in rabbit using human growth hormone as the immunogen.Purity:Min. 95%MAT1 antibody
MAT1 antibody is a polyclonal antibody that specifically targets the activated form of alpha-fetoprotein (AFP) in human serum. This antibody has been shown to neutralize the chemokine activity of AFP, which plays a crucial role in various biological processes. Additionally, MAT1 antibody has genotoxic effects on cancer cells by inhibiting the activity of certain phosphatases and tyrosine kinase receptors. It can be used in bioassays to study the trifunctional nature of AFP as a growth factor and chemokine. Moreover, MAT1 antibody is widely used in life sciences research for its anti-beta amyloid properties, making it an essential tool for studying neurodegenerative diseases such as Alzheimer's. With its high specificity and sensitivity, this antibody ensures accurate and reliable results in various experimental settings.Lck antibody
The Lck antibody is a highly specialized product in the field of Life Sciences. It is a growth factor that exhibits colloidal properties, which contribute to its high viscosity. This antibody is specifically designed to target and bind to Lck, a protein kinase involved in signal transduction pathways. By binding to Lck, this antibody can modulate its activity and downstream signaling events.GJA5 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of GJA5 antibody, catalog no. 70R-6109Purity:Min. 95%MEF2A antibody
The MEF2A antibody is a polyclonal antibody that targets the growth factor MEF2A. It is used in life sciences research to study the role of MEF2A in various cellular processes. This antibody specifically binds to MEF2A and can be used for applications such as immunofluorescence, immunohistochemistry, and western blotting. Additionally, it has been shown to have neutralizing properties against interferon-gamma (IFN-gamma) and basic protein autoantibodies. The MEF2A antibody is a valuable tool for researchers studying endothelial growth, chemokine signaling, and intraocular diseases.
