Biochemicals and Reagents

<p>FGB antibody was raised in Mouse using a purified recombinant fragment of human FGB (aa30-300) expressed in E. coli as the immunogen.</p>

<p>CDKL3 antibody was raised in rabbit using residues 414-428 [NCNGLKENPHCGGSV] of the 50 kDa human NKIAMRE protein as the immunogen.</p>

<p>CD89 antibody was raised in Mouse using Soluble CD89 as the immunogen.</p>

<p>The PGM2 protein is a carbon quantum growth factor that has been pegylated for enhanced stability. It belongs to the group of conjugated proteins and exhibits various biological activities. PGM2 has shown potential as a therapeutic agent in the field of Life Sciences due to its ability to interact with erythropoietin, angiotensin-converting enzyme, alpha-fetoprotein, and other important molecules in the body. It can also be used as a monoclonal antibody or peptide agent in targeted therapies. Additionally, PGM2 has demonstrated interactions with chemokines and collagen, making it a versatile protein with multiple applications. Its efficacy has been confirmed through electrode studies and testing in human serum.</p>

<p>Conjugated Buprenorphine-BSA hapten</p>

<p>Rabbit polyclonal HNRNPD antibody (biotin)</p>

<p>Mouse monoclonal LIPG antibody</p>

<p>CASP12 antibody was raised in Rabbit using Human CASP12 as the immunogen</p>

<p>Sheep polyclonal Urochloralic Acid antibody</p>

<p>IL17B antibody was raised in using highly pure recombinant human IL-17B as the immunogen.</p>

<p>GHRHR antibody was raised using the middle region of GHRHR corresponding to a region with amino acids PYPVACPVPLELLAEEESYFSTVKIIYTVGHSISIVALFVAITILVALRR</p>

<p>UCHL3 antibody was raised in rabbit using a synthetic peptide conjugated to KLH as the immunogen.</p>

<p>ECHDC1 antibody was raised using the middle region of ECHDC1 corresponding to a region with amino acids GVMMLQLLEKVIELENWTEGKGLIVRGAKNTFSSGSDLNAVKSLGTPEDG</p>

<p>The KAP1 antibody is a highly effective tool for researchers in the field of life sciences. This polyclonal antibody specifically targets and binds to KAP1, a protein involved in various cellular processes. The antibody is colloidal in nature, allowing for easy and efficient detection of KAP1 in samples.</p>

<p>MTRF1L antibody was raised using the N terminal of MTRF1L corresponding to a region with amino acids ELFTRGGPLRTFLERQAGSEAHLKVRRPELLAVIKLLNEKERELRETEHL</p>

<p>The SMS antibody is a highly specialized monoclonal antibody used in the field of Life Sciences. It has been extensively studied for its ability to neutralize epidermal growth factor (EGF) and interleukin-6 (IL-6), two important signaling molecules involved in cellular growth and inflammation. This antibody specifically targets the glycoprotein receptors on the cell surface, blocking their interaction with EGF and IL-6 and preventing downstream signaling events.</p>

<p>IL28R alpha antibody was raised using a synthetic peptide corresponding to a region with amino acids QDVTYFVAYQSSPTRRRWREVEECAGTKELLCSMMCLKKQDLYNKFKGRV</p>

<p>Mouse monoclonal Exendin 4 antibody</p>

<p>Tryptophan Hydroxylase antibody is a highly specialized antibody used in Life Sciences research. It is designed to target and bind to tryptophan hydroxylase, an enzyme involved in the synthesis of serotonin. This antibody can be used for various applications, including immunohistochemistry and Western blotting, to study the expression and localization of tryptophan hydroxylase in different tissues and cell types.</p>

<p>The Myotubularin antibody is a synthetic polypeptide that acts as an antigen in the body. It is commonly used in research and diagnostic applications to detect and study myotubularin, a protein involved in various cellular processes. This antibody specifically targets myotubularin and can be used to identify its presence or absence in biological samples.</p>

<p>Rabbit polyclonal CDC25B antibody (Ser323)</p>

<p>Mouse monoclonal DNAJB1 antibody</p>

<p>PNPLA5 antibody was raised using the C terminal of PNPLA5 corresponding to a region with amino acids NMALEVFSRTKAQLLGPISPPATRVLETSPLQPQIAPHREELGPTHQA</p>

<p>B71 antibody was raised in rabbit using highly pure recombinant murine B7-1 (Mouse B7-1) as the immunogen.</p>

<p>Rabbit polyclonal RABL2A antibody</p>

<p>Purified recombinant EBNA1BP2 protein (His tag)</p>

<p>FRK antibody was raised using the N terminal of FRK corresponding to a region with amino acids LCSPQSQRHGHYFVALFDYQARTAEDLSFRAGDKLQVLDTLHEGWWFARH</p>

<p>IL7 antibody was raised in rabbit using highly pure recombinant human IL-7 as the immunogen.</p>

<p>CTCFL antibody was raised in rabbit using the N terminal of CTCFL as the immunogen</p>

<p>Enhanced Universal Diluent/Blocker/Stabilizer for use in IHC</p>

<p>1-591 amino acids: MRGSHHHHHH GMASMTGGQQ MGRDLYDDDD KDRWGSHMFG KRKKRVEISA PSNFEHRVHT GFDQHEQKFT GLPRQWQSLI EESARRPKPL VDPACITSIQ PGAPKTIVRG SKGAKDGALT LLLDEFENMS VTRSNSLRRD SPPPPARARQ ENGMPEEPAT TARGGPGKAG SRGRFAGHSE AGGGSGDRRR AGPEKRPKSS REGSGGPQES SRDKRPLSGP DVGTPQPAGL ASGAKLAAGR PFNTYPRADT DHPSRGAQGE PHDVAPNGPS AGGLAIPQSS SSSSRPPTRA RGAPSPGVLG PHASEPQLAP PACTPAAPAV PGPPGPRSPQ REPQRVSHEQ FRAALQLVVD PGDPRSYLDN FIKIGEGSTG IVCIATVRSS GKLVAVKKMD LRKQQRRELL FNEVVIMRDY QHENVVEMYN SYLVGDELWV VMEFLEGGAL TDIVTHTRMN EEQIAAVCLA VLQALSVLHA QGVIHRDIKS DSILLTHDGR VKLSDFGFCA QVSKEVPRRK SLVGTPYWMA PELISRLPYG PEVDIWSLGI MVIEMVDGEP PYFNEPPLKA MKMIRDNLPP RLKNLHKVSP SLKGFLDRLL VRDPAQRATA AELLKHPFLA KAGPPASIVP LMRQNRTR</p>

<p>Purified recombinant TXNRD3NB protein (His tag)</p>

<p>VLDL protein is a monoclonal antibody that belongs to the category of Proteins and Antigens. It is commonly used in Life Sciences research and has various applications. VLDL protein has been shown to have colony-stimulating properties, promoting the growth and development of cells. It also plays a role in human serum by interacting with other molecules such as epidermal growth factor. Additionally, VLDL protein can neutralize autoantibodies, which are antibodies that target the body's own tissues. This monoclonal antibody can also interact with calmodulin and phosphatase, two important proteins involved in cellular signaling pathways. Furthermore, VLDL protein is associated with low-density lipoproteins (LDL) and can influence their levels in the blood. Overall, VLDL protein is a versatile molecule with diverse functions in biological systems.</p>

<p>The SMS antibody is a powerful tool in the field of Life Sciences. It is an anti-EGFR (epidermal growth factor receptor) antibody that specifically targets the activated form of EGFR. This antibody has been extensively studied and proven to be effective in inhibiting the activity of EGFR, which plays a crucial role in various cellular processes including cell growth, proliferation, and survival.</p>

<p>Purified Polyclonal TCP1 zeta antibody</p>

<p>Mouse monoclonal HLAABC antibody (biotin)</p>

<p>Rabbit polyclonal SPRR3 antibody</p>

<p>Purified Polyclonal Cytochrome P450 1A1/2 antibody</p>

<p>The ACO2 antibody is a highly specific monoclonal antibody that binds to ACO2, an enzyme involved in the tricarboxylic acid cycle. This antibody has been extensively studied and validated for its use in various research applications in the field of life sciences. It can be used for the detection and quantification of ACO2 in human hepatocytes, as well as for studying the role of ACO2 in cellular processes such as metabolism and energy production. The ACO2 antibody has also been shown to interact with other binding proteins, including interferon and chemokine receptors such as CXCR4. Its immobilization on electrodes allows for efficient detection and analysis of ACO2 levels in biological samples, making it a valuable tool for researchers working in the fields of molecular biology and biochemistry.</p>

<p>Rabbit polyclonal FOXH1 antibody</p>

<p>Mouse monoclonal TOM70 antibody</p>

<p>Turkey RBC antibody (Texas Red) was raised in rabbit using turkey erythrocytes as the immunogen.</p>

<p>The GATA4 antibody is a highly specific and targeted molecule drug that plays a crucial role in the field of Life Sciences. It is known to regulate various processes such as fatty acid metabolism, insulin production, and plasma levels. This antibody is designed to bind to GATA4, a transcription factor involved in the regulation of gene expression.</p>

<p>FBXO5 antibody was raised using the C terminal of FBXO5 corresponding to a region with amino acids ASVQKSAAQTSLKKDAQTKLSNQGDQKGSTYSRHNEFSEVAKTLKKNESL</p>

<p>NASP antibody was raised using a synthetic peptide corresponding to a region with amino acids KEAEGSSAEYKKEIEELKELLPEIREKIEDAKESQRSGNVAELALKATLV</p>

<p>Purified Rabbit polyclonal PECAM1 antibody (Tyr713)</p>

<p>The TFAP2A antibody is a monoclonal antibody that targets the transcription factor AP-2 alpha (TFAP2A). This antibody is commonly used in Life Sciences research to study the role of TFAP2A in various cellular processes. TFAP2A is known to regulate the expression of genes involved in fatty acid metabolism, epidermal growth factor signaling, and cell proliferation. The TFAP2A antibody specifically recognizes and binds to TFAP2A, allowing researchers to investigate its function and localization within cells. This antibody can be used in techniques such as immunofluorescence, immunohistochemistry, and Western blotting to detect and analyze TFAP2A expression levels. With its high specificity and sensitivity, the TFAP2A antibody is an invaluable tool for studying the intricate mechanisms of gene regulation and cellular processes mediated by TFAP2A.</p>

<p>Rabbit polyclonal MAK antibody (Tyr159)</p>

<p>The BRCA1 antibody is a highly specialized cytotoxic agent used in life sciences research. It is available as both polyclonal and monoclonal antibodies. This antibody specifically targets the BRCA1 protein, which is involved in DNA repair and maintenance of genomic stability. By binding to BRCA1, the antibody disrupts its function, leading to cell death.</p>

<p>MRPL10 antibody was raised using the N terminal of MRPL10 corresponding to a region with amino acids HRRVMHFQRQKLMAVTEYIPPKPAIHPSCLPSPPSPPQEEIGLIRLLRRE</p>

<p>The PDIA4 antibody is a monoclonal antibody used in life sciences research. It is specifically designed to target and neutralize PDIA4, a protein involved in various cellular processes. This antibody has been shown to have a significant impact on mesenchymal stem cells and endothelial growth, making it a valuable tool for studying these cell types. Additionally, the PDIA4 antibody can be used in techniques such as immunofluorescence and immunohistochemistry to detect the presence of PDIA4 in biological samples. Its high specificity and sensitivity make it an ideal choice for researchers working with PDIA4-related studies.</p>

<p>ANAPC7 antibody was raised using the C terminal of ANAPC7 corresponding to a region with amino acids ALSLDPNDQKSLEGMQKMEKEESPTDATQEEDVDDMEGSGEEGDLEGSDS</p>

<p>Purified recombinant Human KRT19 protein (His tag)</p>

<p>SOX17 antibody was raised in rabbit using the C terminal of SOX17 as the immunogen</p>

<p>The GPR34 antibody is a highly specialized antibody used in Life Sciences research. It is specifically designed to target and bind to the GPR34 antigen, which plays a crucial role in various cellular processes. This antibody is commonly used in studies related to sclerostin, collagen, and other nuclear proteins.</p>

<p>Rat monoclonal Granzyme B antibody (biotin)</p>

<p>The CHK1 antibody is a polyclonal antibody that specifically targets the hyaluronan receptors. It is widely used in life sciences research for the immobilization and detection of biomolecules. This antibody has been shown to be highly effective in detecting and quantifying mesenchymal stem cells that are activated. The CHK1 antibody can also be used in various applications such as chromatographic and colloidal assays. Additionally, this monoclonal antibody has cytotoxic properties and has been proven to effectively target collagen in blood plasma samples. With its high specificity and sensitivity, the CHK1 antibody is a valuable tool for researchers in the field of life sciences.</p>

<p>Rabbit polyclonal GPR156 antibody</p>

<p>The MDM2 antibody is a highly activated antibody used in Life Sciences research. It belongs to the family of monoclonal antibodies and is colloidal in nature. This antibody targets the MDM2 protein, which plays a crucial role in regulating cell growth and division. By binding to MDM2, this antibody inhibits its function and prevents it from interacting with other proteins involved in cell signaling pathways.</p>

<p>ALKBH3 antibody was raised using a synthetic peptide corresponding to a region with amino acids EMRKKPPPEENGDYTYVERVKIPLDHGTLLIMEGATQADWQHRVPKEYHS</p>

<p>The Histone H4 antibody is a growth factor monoclonal antibody that specifically binds to histone H4 proteins. It is widely used in Life Sciences research for various applications, including studying chromatin structure, gene regulation, and epigenetics. This antibody has the ability to neutralize histone H4 binding proteins and can be used to investigate their function. Additionally, the Histone H4 antibody has been shown to have reactive properties, making it an ideal tool for detecting histone H4 modifications and protein-protein interactions. Its high specificity and sensitivity make it a valuable tool for researchers working on anticancer agents, interferon signaling pathways, chemokine biology, antiviral responses, cytotoxicity studies, and multidrug resistance mechanisms. With its versatility and reliability, the Histone H4 antibody is an essential component of any research arsenal in the field of Life Sciences.</p>

<p>Mouse monoclonal Episialin antibody</p>

<p>KLHL5 antibody was raised in rabbit using the N terminal of KLHL5 as the immunogen</p>

<p>The NMT2 antibody is a powerful tool in the field of Life Sciences. This monoclonal antibody has the ability to neutralize multidrug resistance and inhibit the growth of hormone peptides. It targets lipase enzymes, including lipoprotein lipase, and has cytotoxic effects on adipose cells. Additionally, the NMT2 antibody has been shown to have natriuretic properties and can neutralize transforming growth factor-beta (TGF-beta). With its potent antibiotic activity and specificity, this monoclonal antibody is an invaluable asset in various research applications.</p>

<p>Purified recombinant ZG16 protein (His tag)</p>

<p>Rabbit polyclonal MIA2 antibody</p>

<p>RAB15 antibody was raised using the N terminal of RAB15 corresponding to a region with amino acids SSHISTIGVDFKMKTIEVDGIKVRIQIWDTAGQERYQTITKQYYRRAQGI</p>

<p>The Haloperidol antibody is a nuclear monoclonal antibody that targets the tyrosine protein complex. It has been specifically designed to neutralize the effects of Haloperidol, a commonly used antipsychotic medication. This antibody binds to the target protein, preventing its interaction with other molecules and inhibiting its activity. The Haloperidol antibody has been extensively tested and validated for use in various applications, including research in life sciences. It is produced using high-quality excipients and inhibitors to ensure stability and efficacy. Additionally, this antibody has shown promising results in studies involving insulin-like growth factor binding proteins, fibronectin, collagen, and low-density lipoprotein receptors. With its specificity and reliability, the Haloperidol antibody is a valuable tool for researchers in the field of multidrug therapy.</p>

<p>Mouse monoclonal ARL11 antibody</p>

<p>Rabbit Polyclonal LENG8 antibody</p>

<p>Protein kinase B (also known as RAC-alpha serine/threonine-protein kinase: Atk) is a serum and glucocorticoid-regulated protein kinase with three highly homologous isoforms (Akt1, 2 and 3). Akt1 and Akt3 are the predominant isoforms expressed in the brain, whereas Akt2 is mainly expressed in skeletal muscle and embryonic brown fat. These proteins play major regulatory roles in a range of physiological processes including: growth, proliferation, cell survival, angiogenesis, metabolism and Akt is also considered a proto-oncogene.Dysregulation in the Akt pathway is frequently associated with diseases like cancer and diabetes; mutations in pathway components such as PI3K, PTEN, or Akt itself can result in enhanced cell survival, uncontrolled growth, and resistance to treatment in cancer, as well as impaired glucose uptake in diabetes. Given its central role in these processes, Akt is a primary target in therapeutic research focused on regulating growth and metabolism.</p>

<p>The PKD2 antibody is a monoclonal antibody that specifically targets potassium channels. It is used in life sciences research to study the role of these channels in various cellular processes. The PKD2 antibody has been shown to neutralize oxidative damage by binding to specific epitopes on the protein. This antibody can be used in various applications, such as Western blotting, immunohistochemistry, and flow cytometry. The PKD2 antibody is highly reactive and exhibits high specificity towards its target. Its binding affinity allows for accurate detection and quantification of the protein of interest. Researchers can rely on this antibody to provide reliable and reproducible results in their experiments.</p>

<p>ADD3 antibody was raised in rabbit using the C terminal of ADD3 as the immunogen</p>

<p>Mouse monoclonal EPSP synthase antibody</p>

<p>MRGSHHHHHH GMASMTGGQQ MGRDLYDDDD KDRWGSHMPP VGGKKAKKGI LERLNAGEIV IGDGGFVFAL EKRGYVKAGP WTPEAAVEHP EAVRQLHREF LRAGSNVMQT FTFYASEDKL ENRGNYVLEK ISGQEVNEAA CDIARQVADE GDALVAGGVS QTPSYLSCKS ETEVKKVFLQ QLEVFMKKNV DFLIAEYFEH VEEAVWAVET LIASGKPVAA TMCIGPEGDL HGVPPGECAV RLVKAGASII GVNCHFDPTI SLKTVKLMKE GLEAARLKAH LMSQPLAYHT PDCNKQGFID LPEFPFGLEP RVATRWDIQK YAREAYNLGV RYIGGCCGFE PYHIRAIAEE LAPERGFLPP ASEKHGSWGS GLDMHTKPWV RARARKEYWE NLRIASGRPY NPSMSKPDGW GVTKGTAELM QQKEATTEQQ LKELFEKQKF KSQ</p>

<p>CHERP antibody was raised using the middle region of CHERP corresponding to a region with amino acids SERLLAAVEAFYSPPSHDRPRNSEGWEQNGLYEFFRAKMRARRRKGQEKR</p>

<p>Syntrophin Beta 1 antibody was raised using a synthetic peptide corresponding to a region with amino acids GAGAGHPGAGGAQPPDSPAGVRTAFTDLPEQVPESISNQKRGVKVLKQEL</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of NUP50 antibody, catalog no. 70R-3057</p>

<p>UNC50 antibody was raised using a synthetic peptide corresponding to a region with amino acids LPSTSVNSLVQGNGVLNSRDAARHTAGAKRYKYLRRLFRFRQMDFEFAAW</p>

<p>Rabbit polyclonal SNX9 antibody</p>

<p>Heparin Binding Protein (HBP) is a medicament that belongs to the category of proteins and antigens in the field of life sciences. It is a growth factor that plays a crucial role in various biological processes. HBP has been studied extensively for its potential therapeutic applications, particularly in mucopolysaccharidosis type disorders.</p>

<p>Synaptojanin 1 antibody was raised using the N terminal of SYNJ1 corresponding to a region with amino acids IDSSDEDRISEVRKVLNSGNFYFAWSASGISLDLSLNAHRSMQEQTTDNR</p>

<p>Purified recombinant CD33 protein (His tag)</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of LOC730270 antibody, catalog no. 20R-1271</p>

<p>Mouse PMN antibody (FITC) was raised in rabbit using mouse PMNs as the immunogen.</p>

<p>Purified recombinant MMP28 protein (His tag)</p>

<p>Salbutamol-BSA is a protein and antigen conjugate that is commonly used in research and laboratory settings. It is an acidic compound that has been conjugated with bovine serum albumin (BSA). Salbutamol-BSA can be used as a tool to study various biological processes, such as the binding of chemokines, epidermal growth factors, or monoclonal antibodies to specific cell antigens. It can also be used in immunoassays to detect the presence of specific proteins or antigens.</p>

<p>Oncostatin M antibody was raised in rabbit using highly pure recombinant human oncostatin M as the immunogen.</p>

<p>The Androgen Receptor antibody is a highly specific antibody that targets the androgen receptor, a key molecule involved in various biological processes. This antibody is widely used in Life Sciences research as a tool to study and understand the role of androgens in different cellular pathways.</p>

<p>Rabbit polyclonal SRP68 antibody</p>

<p>The ITGB1 antibody is a highly specialized monoclonal antibody that targets the human serum and interferon. It is designed for use in Life Sciences research, particularly in the field of apoptosis-inducing factors. This antibody has been developed using advanced techniques, including magnetic particles and expression plasmids. It specifically binds to metal-binding proteins and necrosis factor-related apoptosis-inducing markers, making it a valuable tool for studying cell death pathways. Additionally, the ITGB1 antibody has shown potential as an erbb2 inhibitor and tnf-related apoptosis-inducing agent. Its multispecific nature allows for versatile applications in various research settings.</p>

<p>GPR149 antibody was raised in rabbit using a synthetic peptide conjugated to KLH as the immunogen.</p>

<p>Lcn2 protein is a conjugated protein that functions as a chemokine and growth factor. It plays a role in various biological processes, including heparin-induced thrombocytopenia and endothelial growth. Lcn2 protein has been shown to be activated by oncostatin and interferon, and it also neutralizes the effects of TNF-α. This protein is commonly used in life sciences research and can be detected using monoclonal antibodies. It is often included as an ingredient in formulations with other excipients for stability and efficacy.</p>

<p>The USP5 antibody is a highly specific monoclonal antibody that targets glycan structures on chimeric proteins. It has been extensively used in the field of Life Sciences for various applications, including the detection and quantification of interferon levels in human serum. This antibody exhibits high affinity and specificity towards its target, making it a valuable tool for research and diagnostic purposes.</p>

<p>MGC4172 antibody was raised using the middle region of MGC4172 corresponding to a region with amino acids DGHIININSMSGHRVLPLSVTHFYSATKYAVTALTEGLRQELREAQTHIR</p>

<p>BRAF antibody is a highly specialized monoclonal antibody that targets the BRAF protein, which plays a crucial role in cell signaling pathways. This antibody specifically binds to the activated form of BRAF, inhibiting its activity and preventing downstream signaling events. It has been extensively studied and proven to be effective in various research areas, particularly in the field of Life Sciences.</p>

<p>The GFAP antibody is a polyclonal antibody that specifically targets glial fibrillary acidic protein (GFAP). It is commonly used in the field of Life Sciences for various research applications. This antibody recognizes and binds to GFAP, which is an intermediate filament protein found mainly in astrocytes. By targeting GFAP, researchers can study the role of astrocytes in different physiological and pathological conditions.</p>

<p>Mouse monoclonal CST4 antibody</p>

<p>ZDHHC18 antibody was raised using the middle region of ZDHHC18 corresponding to a region with amino acids SFTDPGILPRATVCEAAALEKQIDNTGSSTYRPPPRTREVLINGQMVKLK</p>

<p>The TRIM33 antibody is a highly specialized antibody that targets glial fibrillary acidic protein (GFAP). It is commonly used in the field of Life Sciences for various applications such as immunoassays, immunohistochemistry, and western blotting. This monoclonal antibody specifically recognizes and binds to GFAP, allowing for the detection and quantification of this protein in different biological samples.</p>