Biochemicals and Reagents
Biochemicals and reagents are fundamental substances for research and development in fields such as biotechnology, molecular biology, pharmacology, and medicine. These products are essential for a variety of applications, including compound synthesis, biological sample analysis, metabolic process research, and drug production. At CymitQuimica, we offer a wide selection of high-quality, high-purity biochemicals and reagents suitable for various scientific and industrial needs. Our catalog includes enzymes, antibodies, nucleic acids, amino acids, and many other products, all designed to support researchers and professionals in their research and development projects, ensuring reliable and reproducible results.
Subcategories of "Biochemicals and Reagents"
- Biomolecules(98,557 products)
- By Biological Target(101,015 products)
- By Pharmacological Effects(6,941 products)
- Cryopreservatives(21 products)
- Desinfectants and Related Compounds(28 products)
- Hormones(530 products)
- Plant Biology(6,903 products)
- Secondary Metabolites(14,369 products)
Found 130563 products of "Biochemicals and Reagents"
Sort by
Purity (%)
0
100
|
0
|
50
|
90
|
95
|
100
HMGCL Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of HMGCL antibody, catalog no. 70R-5397Purity:Min. 95%P2rx2 antibody
P2rx2 antibody was raised in rabbit using the middle region of P2rx2 as the immunogenPurity:Min. 95%SLC26A8 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of SLC26A8 antibody, catalog no. 70R-1764
Purity:Min. 95%CIDEC antibody
CIDEC antibody is a polyclonal antibody that is commonly used in life sciences research. It is specifically designed to detect and bind to CIDEC, an antigen that plays a crucial role in lipid metabolism and energy homeostasis. This antibody has been extensively validated for use in immunohistochemistry and other applications.GPR115 antibody
GPR115 antibody was raised in rabbit using a synthetic peptide conjugated to KLH as the immunogen.
Purity:Min. 95%MSH2 antibody
MSH2 antibody was raised using a synthetic peptide corresponding to a region with amino acids KMSAVDGQRQVGVGYVDSIQRKLGLCEFPDNDQFSNLEALLIQIGPKECVINSIG1 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of INSIG1 antibody, catalog no. 70R-6636Purity:Min. 95%LYN antibody
LYN antibody was raised using the N terminal of LYN corresponding to a region with amino acids DPTSNKQQRPVPESQLLPGQRFQTKDPEEQGDIVVALYPYDGIHPDDLSF
Cytokeratin 20 antibody
Cytokeratin 20 antibody was raised in mouse using electrophoretically purified cytokeratin 20 from human intestinal mucosa as the immunogen.
ZNF610 antibody
ZNF610 antibody was raised in rabbit using the N terminal of ZNF610 as the immunogenPurity:Min. 95%Zika virus NS1 antibody
The Zika virus NS1 antibody is a potent treatment and/or prophylaxis option for individuals exposed to the Zika virus. This antibody specifically targets the NS1 protein found in the virus and effectively neutralizes its harmful effects. It has been extensively tested on human serum samples, demonstrating strong binding affinity with NS1 proteins.ALDOB antibody
ALDOB antibody was raised using the middle region of ALDOB corresponding to a region with amino acids KLDQGGAPLAGTNKETTIQGLDGLSERCAQYKKDGVDFGKWRAVLRIADQGAN Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of GAN antibody, catalog no. 70R-4075Purity:Min. 95%E2F3 antibody
E2F3 antibody was raised in rabbit using the C terminal of E2F3 as the immunogenPurity:Min. 95%HPV16 E7 antibody
The HPV16 E7 antibody is a dinuclear antibody that specifically targets the human papillomavirus type 16 (HPV16) E7 protein. This antibody is widely used in Life Sciences research to study the expression and function of the HPV16 E7 protein. It can be used in various applications, including Western blotting, immunohistochemistry, and immunofluorescence. The HPV16 E7 antibody is produced using an expression plasmid containing the HPV16 E7 gene. It has been extensively validated and shows high specificity and sensitivity for detecting HPV16 E7 protein in human serum or tissue samples. When used in experiments, this monoclonal antibody effectively binds to the HPV16 E7 protein, leading to lysis of cells expressing this viral protein. It can also be used to detect the presence of HPV16 E7 in virus-infected cells or as a tool for studying the role of HPV16 E7 in cellular processes. Furthermore, this antibody has beenPIP3-E Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of PIP3-E antibody, catalog no. 70R-3184Purity:Min. 95%N6AMT1 antibody
N6AMT1 antibody was raised using a synthetic peptide corresponding to a region with amino acids MAGENFATPFHGHVGRGAFSDVYEPAEDTFLLLNALEAAAAELAGVEICLTransferrin antibody
The Transferrin antibody is a highly effective and neutralizing monoclonal antibody that is designed to target and inhibit the activity of transferrin. This antibody works by binding to transferrin molecules, preventing them from carrying out their normal functions. By doing so, it effectively neutralizes the activity of transferrin and disrupts processes such as lysis, which are dependent on its function.ARRY-797
CAS:ARRY-797 is a molecule that inhibits the adenosine A3 receptor and is being developed for inflammatory diseases, including inflammatory bowel disease. ARRY-797 has been shown to have anti-arrhythmogenic effects and may be useful in the treatment of arrhythmia. It also inhibits p38, which regulates inflammation in bowel disease. ARRY-797 is a crystalline polymorph that transforms into a different crystalline form under certain conditions.Formula:C22H26F2N4O2Purity:Min. 95%Molecular weight:416.5 g/molCHD1L antibody
CHD1L antibody was raised using the middle region of CHD1L corresponding to a region with amino acids DALPAAEGGSRDQEEGKNHMYLFEGKDYSKEPSKEDRKSFEQLVNLQKTLGAB1 antibody
The GAB1 antibody is a powerful tool used in Life Sciences research. It is a polyclonal antibody that specifically targets the growth factor GAB1. This antibody is widely used in various applications, including Western blotting, immunohistochemistry, and ELISA.
GPN2 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of ATPBD1B antibody, catalog no. 70R-3175Purity:Min. 95%Flufenamic acid-d4
CAS:Flufenamic acid-d4 is a medicinal compound with potent anticancer properties. It has been shown to inhibit the growth of cancer cells by inducing apoptosis and inhibiting the activity of kinases that are involved in tumor development. Flufenamic acid-d4 has been used as an inhibitor in various studies on human and Chinese hamster ovary cells, showing promising results in reducing the proliferation of cancer cells. This compound is also commonly found in urine samples and has been studied for its potential as a diagnostic marker for certain cancers. With its potent anticancer properties, flufenamic acid-d4 holds great promise as a potential therapeutic agent for treating various types of cancer.Formula:C5H16N4O4SPurity:Min. 95%Molecular weight:228.27 g/molTau antibody
The Tau antibody is a highly specialized monoclonal antibody that is used in various research applications. This antibody specifically targets and binds to the Tau protein, which plays a crucial role in the development of neurodegenerative diseases such as Alzheimer's disease. The Tau antibody is designed to recognize and bind to specific regions of the Tau protein, allowing for accurate detection and analysis.Purity:Min. 95%MRGPRX2 antibody
MRGPRX2 antibody was raised in rabbit using a synthetic peptide conjugated to KLH as the immunogen.Purity:Min. 95%BACH1 antibody
BACH1 antibody was raised in rabbit using residues 1233-1249 [NFKPSPSKNKGMFPGFK] of the human BACH1 protein as the immunogen.
Purity:Min. 95%TGFB3 antibody
TGFB3 antibody was raised in rabbit using the middle region of TGFB3 as the immunogenPurity:Min. 95%Cdx2 antibody
The Cdx2 antibody is a highly specific monoclonal antibody that targets the Cdx2 protein. This protein plays a crucial role in regulating gene expression and cell differentiation in various tissues, including the gastrointestinal tract. The Cdx2 antibody can be used for research purposes in the field of life sciences to study the function and localization of Cdx2.Galnt11 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of Galnt11 antibody, catalog no. 70R-8825Purity:Min. 95%MCM6 antibody
MCM6 antibody was raised using the C terminal of MCM6 corresponding to a region with amino acids RIIEKVIHRLTHYDHVLIELTQAGLKGSTEGSESYEEDPYLVVNPNYLLEHuman Olfactory Lobe Tissue Lysate
Fresh tissue lysate prepared from the olfactory lobe of human brain
Purity:Min. 95%CEP-28122
CAS:CEP-28122 is a selective and potent small-molecule inhibitor, which is derived from chemical synthesis targeting receptor tyrosine kinases, specifically the fibroblast growth factor receptors (FGFRs). Its mode of action involves the competitive inhibition of ATP binding, thereby preventing the phosphorylation cascade necessary for signal transduction downstream of FGFRs. By inhibiting these pathways, CEP-28122 effectively impedes processes such as cell proliferation and angiogenesis, which are critical in various pathological conditions including cancer.Formula:C28H35ClN6O3Purity:Min. 95%Molecular weight:539.07 g/molNOX2 Antibody
The NOX2 Antibody is a neuroprotective and neutralizing agent that belongs to the field of Life Sciences. It is a glycosylated hormone peptide that targets specific receptors in the body. This antibody has been extensively researched and developed for its therapeutic potential in various applications.Paxillin antibody
The Paxillin antibody is a highly specialized antibody used in Life Sciences research. It plays a crucial role in various cellular processes, including cell adhesion, migration, and signaling. This antibody specifically targets paxillin, an important protein involved in the regulation of cell growth and movement.Purity:Min. 95%IGF1 protein (Mouse)
Region of IGF1 protein corresponding to amino acids GPETLCGAEL VDALQFVCGP RGFYFNKPTG YGSSIRRAPQ TGIVDECCFR SCDLRRLEMY CAPLKPTKAA.Purity:Min. 95%PABP Antibody
The PABP Antibody is a highly effective monoclonal antibody that targets the glycoprotein known as Poly(A)-binding protein (PABP). This antibody is specifically designed to immobilize and neutralize PABP, making it an ideal tool for various applications in the field of Life Sciences.ApoSAA1 protein
Region of Apo-SAA1 protein corresponding to amino acids MRSFFSFLGE AFDGARDMWR AYSDMREANY IGSDKYFHAR GNYDAAKRGP GGVWAAEAIS NARENIQRFF GRGAEDSLAD QAANEWGRSG KDPNHFRPAG LPEKY.
Purity:Min. 95%Myc protein
Myc protein is a growth factor that plays a crucial role in regulating cell proliferation and differentiation. It is involved in various cellular processes, including the regulation of gene expression and cell cycle progression. Myc protein has been extensively studied in the field of cancer research due to its ability to promote cell growth and division.Purity:Min. 95%α Enolase protein
The alpha Enolase protein is a versatile molecule that plays a crucial role in various biological processes. It has been found to be involved in cell growth, differentiation, and metabolism regulation. This protein has also been identified as a potential target for therapeutic interventions due to its association with several diseases.Purity:Min. 95%MRPL47 antibody
MRPL47 antibody was raised using the middle region of MRPL47 corresponding to a region with amino acids VVQEREDALRLLQTGQERARPGAWRRDIFGRIIWHKFKQWVIPWHLNKRYPurity:Min. 95%PPP4C Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of PPP4C antibody, catalog no. 70R-3051Purity:Min. 95%FHIT protein (His tag)
1-147 amino acids: MSFRFGQHLI KPSVVFLKTE LSFALVNRKP VVPGHVLVCP LRPVERFHDL RPDEVADLFQ TTQRVGTVVE KHFHGTSLTF SMQDGPEAGQ TVKHVHVHVL PRKAGDFHRN DSIYEELQKH DKEDFPASWR SEEEMAAEAA ALRVYFQLEH HHHHHPurity:Min. 95%TWEAK protein
Region of TWEAK protein corresponding to amino acids MKGRKTRARR AIAAHYEVHP RPGQDGAQAG VDGTVSGWEE ARINSSSPLR YNRQIGEFIV TRAGLYYLYC QVHFDEGKAV YLKLDLLVDG VLALRCLEEF SATAASSLGP QLRLCQVSGL LALRPGSSLR IRTLPWAHLK AAPFLTYFGL FQVH.Purity:Min. 95%SNAG1 antibody
SNAG1 antibody was raised in rabbit using the C terminal of SNAG1 as the immunogenPurity:Min. 95%V5 Tag antibody
The V5 Tag antibody is a highly specific monoclonal antibody that is widely used in Life Sciences research. It is commonly used to detect and quantify the expression of proteins tagged with the V5 epitope. This antibody recognizes the V5 epitope, which consists of five amino acids (GKPIPNPLLGLDST) and can be fused to the N- or C-terminus of a protein of interest.p21Cip1 antibody
The p21Cip1 antibody is a highly specific and potent inhibitor of the cryptosporidium parasite. It belongs to the class of polyclonal antibodies, which are known for their ability to target multiple epitopes on a given antigen. This antibody has been extensively studied in the field of Life Sciences and has shown promising results in inhibiting the growth and reproduction of cryptosporidium.Purity:Min. 95%ACTR1B Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of ACTR1B antibody, catalog no. 70R-4052Purity:Min. 95%PTGER3 antibody
PTGER3 antibody was raised using a synthetic peptide corresponding to a region with amino acids ILDPWVYLLLRKILLRKFCQIRYHTNNYASSSTSLPCQCSSTLMWSDHLEPurity:Min. 95%SAMD14 antibody
SAMD14 antibody was raised using the N terminal of SAMD14 corresponding to a region with amino acids HKARAQLLAKGRRHRPSRSRLRDSASSAEDGEGSDGPGGKVTDGCGSPLHTuberin antibody
Tuberin antibody is a polyclonal antibody that specifically targets tuberin, a protein involved in the regulation of cell growth and proliferation. This antibody is commonly used in life sciences research to study the role of tuberin in various cellular processes. It has been shown to bind to tyrosine-phosphorylated tuberin and inhibit its interaction with other proteins, such as interleukins and insulin-like growth factors. Tuberin antibody is available as both polyclonal and monoclonal antibodies, allowing researchers to choose the most suitable option for their experiments. It can be used in various applications, including Western blotting, immunoprecipitation, and immunofluorescence. This antibody is immobilized on a solid support, making it easy to use for protein-protein interaction studies or detection of tuberin in complex samples. Tuberin antibody is highly specific and sensitive, ensuring accurate and reliable results in your research.ICAM1 antibody
The ICAM1 antibody is a monoclonal antibody used in Life Sciences research. It specifically targets and binds to ICAM1, which stands for Intercellular Adhesion Molecule 1. This protein plays a crucial role in cell adhesion and immune response regulation. The binding of the ICAM1 antibody to ICAM1 can inhibit various cellular processes, including the activation of β-catenin, endonuclease activity, and the production of mitogen-activated protein (MAP) kinases such as p38 MAP kinase.EPB42 antibody
EPB42 antibody was raised using the middle region of EPB42 corresponding to a region with amino acids ISTKGVGSDRCEDITQNYKYPEGSLQEKEVLERVEKEKMEREKDNGIRPP
MCM8 antibody
MCM8 antibody was raised using the C terminal of MCM8 corresponding to a region with amino acids IRLTEARARLELREEATKEDAEDIVEIMKYSMLGTYSDEFGNLDFERSQH
Purity:Min. 95%NXF1 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of NXF1 antibody, catalog no. 70R-1323Purity:Min. 95%CD49e antibody
CD49e antibody was raised in rat using C57BL/6 x A/J F1 murine mast cell line MC/10 as the immunogen.KCNK10 antibody
KCNK10 antibody was raised using the C terminal of KCNK10 corresponding to a region with amino acids QGASEDNIINKFGSTSRLTKRKNKDLKKTLPEDVQKIYKTFRNYSLDEEKRORC antibody
RORC antibody was raised in mouse using recombinant Human Rar-Related Orphan Receptor CCofilin antibody
The Cofilin antibody is a highly specialized polyclonal antibody used in Life Sciences research. This antibody specifically targets the protein cofilin, which plays a crucial role in cell movement and cytoskeletal dynamics. By binding to cofilin, this antibody allows researchers to study its function and regulation in various cellular processes.Hepatitis C Virus antibody
Hepatitis C Virus antibody was raised in goat using recombinant NS3 (genotype 1a) as the immunogen.Purity:Min. 95%Internal Standard R46594
Internal standard 3-(2-[4-(4-chlorobenzyl)-1-piperidinyl]ethyl)-2,4-[1h,3H]-quinazoline-dione (R46594)Purity:Min. 95%
