Biochemicals and Reagents

<p>DM1-MCC is an inhibitor of kinases, which are enzymes that play a crucial role in the regulation of various cellular processes. It is derived from urine and has been shown to have potent anticancer activity against human cancer cells. DM1-MCC inhibits the activity of kinases involved in tumor growth and promotes apoptosis, leading to the death of cancer cells. This medicinal compound is a protein analog of maytansine, a natural product from Chinese medicinal plants. DM1-MCC has been extensively studied as an anticancer agent and has shown promising results in preclinical studies. Its potential as a targeted therapy for cancer treatment makes it an exciting area of research for future drug development.</p>

<p>Desloratadine-d7 is a compound derived from sulfadiazine, an industrial chemical. It is commonly used in the production of chamomile extract and has been found to promote the growth of certain types of cells. Desloratadine-d7 acts as an acetyltransferase inhibitor, preventing the transfer of acetyl groups between molecules. This inhibition can have various effects on cell function and metabolism. Additionally, Desloratadine-d7 has been shown to increase biomass production in certain organisms and enhance the expression of basic proteins involved in cellular processes. It also plays a role in the synthesis of xylose, methanol, prasugrel, epidermal growth factor, chemokines, cellulose, glutamate, and fatty acids.</p>

<p>Entacapone amide is an analog of the medicinal compound Entacapone that has shown promising anticancer properties. It works by inhibiting kinases, which are enzymes that play a crucial role in cell growth and division. This inhibitor has been shown to induce apoptosis, or programmed cell death, in cancer cells, making it a potential treatment for various types of tumors. Entacapone amide has been studied extensively in Chinese hamster ovary cells and human urine samples, demonstrating potent activity against a range of cancer cell lines. Its ability to specifically target cancer cells while sparing healthy cells makes it a promising candidate for future cancer therapies.</p>

<p>Dehydro tiamulin is a medicinal compound that has shown promising anticancer properties in human cells. It works by inhibiting specific protein kinases, which are enzymes that play a crucial role in cancer cell growth and survival. Dehydro tiamulin has been shown to induce apoptosis, or programmed cell death, in tumor cells. This compound is an analog of the Chinese herbal medicine Tiamulin, which has been used traditionally for its antibacterial properties. Dehydro tiamulin shows potential as a novel inhibitor for various types of cancer and may be a valuable addition to current cancer treatments.</p>

<p>Please enquire for more information about 5-Hydroxy imazapyr including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>2,2-Dipropylvaleronitrile is an analog of the anti-diabetic drug saxagliptin that has shown promising anticancer activity. It works by inhibiting kinases involved in cancer cell growth and inducing apoptosis, or programmed cell death, in cancer cells. This compound has been tested on human cancer cell lines and has demonstrated potent anticancer effects. 2,2-Dipropylvaleronitrile may also have potential as a urine tumor marker due to its ability to inhibit protein kinases involved in tumor growth. Overall, this compound shows great promise as a potential cancer treatment option.</p>

<p>Enniatin B3 is a potent inhibitor of kinases and has been shown to induce apoptosis in human cancer cells. It is an analog of the naturally occurring enniatins, which are cyclic hexadepsipeptides that have been found to have anticancer properties. Enniatin B3 has been tested on Chinese hamster ovary cells and has been found to be a potent inhibitor of protein kinase C. This compound has also been shown to be a potent inhibitor of vitamin K epoxide reductase, which is involved in the activation of vitamin K-dependent clotting factors. Enniatin B3 has potential as an anticancer agent due to its ability to inhibit tumor growth and induce apoptosis in cancer cells.</p>

<p>Please enquire for more information about Cyclohexanol-d11 including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>C26 Sphingomyelin (d18:1/26:0) is a potent inhibitor that has been found in urine samples. This inhibitor plays a crucial role in the cell cycle, particularly in human cancer cells. It has been shown to induce apoptosis, which is the programmed death of cells, making it an effective anticancer agent. C26 Sphingomyelin inhibits protein kinase activity and has been studied for its potential use as a medicinal compound for treating leukemia and other types of cancer. In Chinese hamster ovary cells, C26 Sphingomyelin was found to be an effective inhibitor of tumor growth, making it an exciting prospect for developing new cancer therapies.</p>

<p>Biscarfentrazone is a potent anticancer drug that induces apoptosis in cancer cells. It works by inhibiting cyclin-dependent kinases, which are enzymes that regulate the cell cycle. Biscarfentrazone has been shown to be effective against a variety of human cancer cell lines, including Chinese hamster ovary cells and medicinal plant-derived cancer cells. This drug specifically targets protein kinase activity, which is essential for tumor growth and survival. As an inhibitor of these kinases, Biscarfentrazone can slow down or even stop the growth of cancer cells. Its unique mechanism of action makes it a promising candidate for anticancer therapy.</p>

<p>Please enquire for more information about Maprotiline-d3 hydrochloride including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Didemnin A is an anticancer drug that inhibits the growth of cancer cells by targeting specific proteins involved in tumor development. It is a potent inhibitor of protein synthesis and has been shown to induce apoptosis in human cancer cells. Didemnin A is derived from a marine tunicate and has medicinal properties that have been used in Chinese traditional medicine for centuries. This drug works by blocking the activity of kinases, which are enzymes that regulate cell growth and division. Didemnin A analogs have also been developed, which may offer improved efficacy and fewer side effects compared to the original compound. Overall, Didemnin A offers promising potential as a novel therapeutic agent for the treatment of various types of cancer.</p>

<p>Cyprazole is an analog of a protein found in Chinese urine that has been shown to have potent anticancer activity. It inhibits the growth of cancer cells by targeting specific kinases involved in tumor cell proliferation and survival. Cyprazole has been shown to induce apoptosis, or programmed cell death, in human cancer cells. This compound is also known for its ability to inhibit the activity of luciferase, an enzyme commonly used in bioluminescence assays. Cyprazole is formulated with mannitol for improved solubility and delivery. As a promising anticancer agent, cyprazole holds great potential for the development of novel cancer therapies and inhibitors.</p>

<p>The proBNP antibody is a monoclonal antibody that specifically targets and inhibits the activity of proBNP, an important biomarker for heart failure. This antibody has been extensively studied and shown to effectively neutralize proBNP in human serum samples, making it a valuable tool in cardiovascular research and diagnostics. By blocking the binding of proBNP to its receptor, this antibody can help regulate the levels of this peptide hormone, which plays a crucial role in fluid balance and cardiac function. Additionally, the proBNP antibody has potential applications in therapeutic interventions for heart failure and other related conditions. Its specificity and high affinity make it an ideal candidate for further investigation in the field of cardiology and life sciences.</p>

<p>AMC arachidonoyl amide is a medicinal compound that has shown promising anticancer properties. It works by inhibiting the activity of certain kinases, which are enzymes involved in cell cycle regulation and tumor growth. This compound has been shown to induce apoptosis (cell death) in human cancer cells, making it a potential candidate for cancer treatment. AMC arachidonoyl amide is also known to inhibit the activity of protein kinases, which play a crucial role in signaling pathways that regulate cell growth and survival. This compound has been found in urine samples from Chinese individuals and is being studied as a potential inhibitor of tumor growth and progression. With its potent anticancer effects, AMC arachidonoyl amide shows great potential as a new class of kinase inhibitors for cancer therapy.</p>

<p>C22 Galactosylceramide (d18:1/22:0) is a potent analog of the naturally occurring glycosphingolipid ceramide. It has been shown to inhibit kinases involved in cancer cell growth and survival, making it a promising anticancer agent. In Chinese hamster ovary cells, C22 Galactosylceramide induces apoptosis and inhibits tumor growth. Additionally, this compound has been found to be a medicinal inhibitor of protein kinase C (PKC), which is involved in many cellular processes such as cell proliferation and differentiation. C22 Galactosylceramide has also been detected in human urine, suggesting that it may have potential as a biomarker for certain diseases. Overall, this compound shows great promise as a therapeutic agent for cancer treatment.</p>

<p>Please enquire for more information about 2,3,6-Tribromophenol including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about (4Z,7Z,10Z,12E,14E,16R,17S,19Z)-16-(((R)-2-((S)-4-Amino-4-carboxybutanamido)-3-((carboxymethyl)amino)-3-oxopropyl)thio)-17-hydroxydo cosa-4,7,10,12,14,19-hexaenoicacid including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Xl413 hydrochloride is a potent inhibitor of the cell cycle and apoptosis in human cancer cells. It works by targeting specific proteins that are involved in regulating the cell cycle, such as mutant kinases. Xl413 hydrochloride has been shown to induce cell death in various types of cancer cells, making it a promising candidate for cancer treatment. This inhibitor has been tested on multiple human cancer cell lines and has demonstrated effective results. Xl413 hydrochloride is a kinase inhibitor that blocks the activity of specific enzymes involved in cell growth and division, ultimately leading to the death of cancer cells. Its ability to specifically target cancer cells makes it an exciting prospect for future cancer therapies.</p>

<p>Provides researchers who have biomolecules labelled with an azide or alkyne and the corresponding click detection reagent with all the necessary reagents to perform a copper-catalyzed ligation reaction. The kit provides sufficient materials to perform up to 25 copper-catalyzed click reactions for subsequent analysis by gel electrophoresis, western blot or mass spectrometry.<br>THPTA as a copper chelating reagent to stabilize a catalytically active Cu(I) to accelerate the rate of CuAAC. The use of copper-chelating ligand also minimizes amount of free copper in solution, thus limiting the generation of reactive oxygen species (ROS) and protecting against undesired oxidative damage side reactions to proteins (e.g., GFP, RPE), nucleic acids (e.g., RNA, oligos), and other biomolecules.Sufficient reagents are provided for 25 labelling reactions containing 50 uL protein solution (1-5 mg/mL).</p>

<p>3β-OH-7-oxocholenic acid is an analog of a substance found in Chinese medicine that has been shown to have potent anti-cancer properties. It acts as an inhibitor of protein kinases, which are enzymes involved in regulating cell growth and division. This compound has been shown to be effective against a variety of cancer cells, including those from human tumors, by inducing cell cycle arrest and apoptosis. In addition, 3β-OH-7-oxocholenic acid has been found to inhibit the growth of mutant cancer cells that are resistant to other inhibitors. Its potential as a cancer treatment makes it an exciting area of study for researchers.</p>

<p>ZBTB12 antibody was raised in rabbit using the N terminal of ZBTB12 as the immunogen</p>

<p>CBFA2T2H antibody was raised in rabbit using the middle region of CBFA2T2H as the immunogen</p>

<p>Purified recombinant DKK3 protein (His tag)</p>

<p>Rat Serum Albumin antibody was raised in rabbit using rat serum as the immunogen.</p>

<p>CENPC1 antibody was raised in mouse using recombinant Human Centromere Protein C 1 (Cenpc1)</p>

<p>TMEM176A antibody was raised in rabbit using the N terminal of TMEM176A as the immunogen</p>

<p>IFN beta protein is a cytotoxic and antiviral protein that acts as an inhibitor of viral replication. It is naturally produced in human serum and plays a crucial role in the immune response against viral infections. IFN beta protein can be used in various applications within the field of Life Sciences, including research on interferons, phosphatases, and other cellular signaling pathways.</p>

<p>ATP6V0A1 antibody was raised using the N terminal of ATP6V0A1 corresponding to a region with amino acids RDLNPDVNVFQRKFVNEVRRCEEMDRKLRFVEKEIRKANIPIMDTGENPE</p>

<p>EsxB protein is a highly specialized and unique molecule that has various applications in the field of Life Sciences. It can be used as a cholinergic agent, a component in DNA vaccines, and as a target for mouse monoclonal antibodies. The EsxB protein can be detected using techniques such as polymerase chain reaction (PCR) or flow immunoassays with streptavidin-coated paramagnetic particles. Recombinant forms of EsxB protein are available for research purposes.</p>

<p>Rabbit polyclonal SYT9 antibody</p>

<p>Rabbit polyclonal MNK1 antibody (Thr250)</p>

<p>ZNF433 antibody was raised in rabbit using the N terminal of ZNF433 as the immunogen</p>

<p>ANKRD47 antibody was raised using the N terminal Of Ankrd47 corresponding to a region with amino acids GPAQLQLVREQMAAALRRLRELEDQARTLPELQEQVRALRAEKARLLAGR</p>

<p>Mouse monoclonal NRBP1 antibody</p>

<p>The BID antibody is a growth factor that belongs to the class of monoclonal antibodies. It targets specific chemokines and has been extensively studied in the field of Life Sciences. The BID antibody has shown great potential in various applications, including lysis assays, glycosylation studies, and as a tool for detecting specific proteins in research experiments. This monoclonal antibody has been used to study the role of epidermal growth factor (EGF) signaling pathway and its interaction with β-catenin and caspase-9. Additionally, it has been used as a diagnostic tool for detecting anti-dnp antibodies and as a therapeutic agent in the treatment of HER2-positive breast cancer alongside trastuzumab. With its high specificity and versatility, the BID antibody is an invaluable tool for researchers in various fields.</p>

<p>Haptoglobin antibody was raised using the N terminal of HP corresponding to a region with amino acids MSALGAVIALLLWGQLFAVDSGNDVTDIADDGCPKPPEIAHGYVEHSVRY</p>

<p>The BMP2 antibody is a highly specialized product in the field of Life Sciences. It is designed to target and inhibit the activity of bone morphogenetic protein 2 (BMP2), a key regulator of various cellular processes. This antibody specifically binds to activated BMP2, preventing its interaction with cellular receptors and downstream signaling pathways.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of Trpv6 antibody, catalog no. 70R-8072</p>

<p>Purified recombinant HCVE2 protein (His tag)</p>

<p>13,14-Dihydro-15-keto-tetranor prostaglandin D2 is an analog of prostaglandin D2 that has been shown to have anticancer properties. It acts as an inhibitor of kinases, which are enzymes that play a crucial role in cancer cell growth and proliferation. This compound has been studied extensively in Chinese patients with various types of cancer, including lung cancer and breast cancer. It has been found to induce apoptosis (programmed cell death) in cancer cells by inhibiting protein synthesis. 13,14-Dihydro-15-keto-tetranor prostaglandin D2 can be administered orally or intravenously and is often formulated with chitosan to increase its bioavailability. This compound can also be detected in urine samples and may serve as a biomarker for the diagnosis and monitoring of certain types of cancer. In addition, 13,14-Dihydro-15-keto-tetranor prostaglandin</p>

<p>Please enquire for more information about 1,2-Dipalmitoleoyl-3-palmitoyl-rac-glycerol including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Rabbit polyclonal FOXN4 antibody</p>

<p>Please enquire for more information about 3-Desmethyl gatifloxacin-d8 including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>(+)-Medioresinol di-o-β-D-glucopyranoside is a potent anticancer agent that has been shown to induce apoptosis in cancer cells. It works by inhibiting kinases, which are enzymes that regulate cell growth and division. This compound has been extensively studied in both Chinese and human cancer models, where it has demonstrated significant tumor inhibition activity. (+)-Medioresinol di-o-β-D-glucopyranoside is an analog of other kinase inhibitors used in medicinal chemistry, making it a promising candidate for the development of new cancer therapies. Additionally, this compound can be found in urine and may have potential as a biomarker for cancer diagnosis or treatment monitoring.</p>

<p>Thiobromadol is a potent inhibitor of cyclin-dependent kinases (CDKs) that are involved in the regulation of cell cycle progression. It has been shown to induce apoptosis in human cancer cells and may have potential as an anticancer agent. Thiobromadol is found in human urine and is believed to be a natural analog of bromadol, a synthetic opioid analgesic. The inhibition of CDKs by thiobromadol results in the suppression of tumor growth and proliferation by blocking the cell cycle at the G1 phase. This protein kinase inhibitor also targets other kinases involved in cancer development, making it a promising candidate for targeted therapy against various types of cancer.</p>

<p>Please enquire for more information about Ezetimibe-13C6 including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>(S)-Bicalutamide-d4 is a potent inhibitor of androgen receptor signaling that is used in the treatment of prostate cancer. It is an analog of bicalutamide, which is a non-steroidal anti-androgen drug that blocks the action of testosterone on cancer cells. (S)-Bicalutamide-d4 has been shown to induce apoptosis in human prostate cancer cell lines and inhibit tumor growth in animal models. It also has inhibitory effects on hyaluronan synthesis and kinase activity, which may contribute to its anti-cancer properties. (S)-Bicalutamide-d4 has been used as a tracer in studies of somatostatin receptors in Chinese hamster ovary cells and urine samples from prostate cancer patients treated with octreotide inhibitors. Its stable isotopic labeling makes it useful for pharmacokinetic studies and metabolic profiling.</p>

<p>Enciprazine is an analog that has shown promising results as an anticancer drug. It is a kinase inhibitor that has been shown to inhibit the growth of cancer cells in both human and Chinese hamster ovary cell lines. Enciprazine also exhibits apoptotic effects on tumor cells, inducing programmed cell death. Additionally, Enciprazine has been shown to inhibit hepcidin, a hormone that regulates iron metabolism and is involved in cancer progression. This drug may have potential as a novel anticancer therapy due to its ability to target multiple pathways involved in cancer growth and progression. Enciprazine has also been found to be an inhibitor of ranitidine uptake into urine, which may have implications for the treatment of gastric ulcers.</p>

<p>Please enquire for more information about 5-methoxy-3-(3-nitroso-1H-indol-2-yl)-1H-indol-2-ol including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>KL002 is a protein kinase inhibitor that has shown potential as an anticancer agent. It targets the cell cycle and induces apoptosis in cancer cells, making it a promising candidate for cancer treatment. KL002 is an analog of xylan, a naturally occurring medicinal compound with anticancer properties. Studies have demonstrated the efficacy of KL002 in inhibiting the growth of human cancer cells, including Chinese hamster ovary cells and breast cancer cells. This inhibitor has also been shown to be effective against tumors in animal models, highlighting its potential as a therapeutic option for cancer patients.</p>

<p>3-Methyl-1-phenyl-2(1H)-pyridinone is a medicinal compound that has shown promising results in inhibiting kinases, which are enzymes that play a crucial role in cell signaling pathways. This compound has been studied extensively for its potential as an anticancer agent due to its ability to induce apoptosis (programmed cell death) in cancer cells. It is a potent inhibitor of protein kinase C and has been found to be effective against various types of tumors, including breast cancer and lung cancer. 3-Methyl-1-phenyl-2(1H)-pyridinone is an analog of the Chinese herbal medicine Shikonin and has also shown activity as a urinary bladder tumor inhibitor. Its potential as a therapeutic agent for cancer treatment makes it an exciting area of research in the field of medicinal chemistry.</p>

<p>Pregna-1,4,16-triene-3,20-dione is a synthetic progestin that is an agonist of the progesterone receptor and has been shown to have antigonadotropic activity. It has also been found to be an activator of the GABA receptor and may act as a calcium channel blocker. Pregna-1,4,16-triene-3,20-dione is used in research as a tool for studying the effects of progestins on the body.</p>

<p>PF-06952229 is an inhibitor analog that targets kinase enzymes. It has been shown to be effective in reducing the activity of certain kinases found in human urine and cancer cells, making it a promising candidate for anticancer therapy. This inhibitor selectively induces apoptosis, or programmed cell death, in tumor cells by inhibiting specific protein kinases that are involved in cancer cell growth and proliferation. PF-06952229 has also demonstrated efficacy against oseltamivir-resistant influenza viruses. This compound is highly selective and does not affect other kinases or proteins, making it a safe and effective treatment option for various types of cancer.</p>

<p>Lyso-PAF C-16-d4 is an analog of lysophosphatidic acid, a lipid mediator that plays a role in cancer and other diseases. It has been shown to inhibit the activity of kinases, which are enzymes involved in cell signaling pathways that regulate cell growth and division. This inhibition leads to apoptosis or programmed cell death in cancer cells. Lyso-PAF C-16-d4 has been studied for its potential as an anticancer agent and has shown promising results in Chinese hamster ovary cells and human urine tumor cells. It also acts as a protein kinase inhibitor, which may contribute to its anticancer properties. Additionally, Lyso-PAF C-16-d4 has been investigated for its potential use in Alzheimer's disease treatment due to its similarity to donepezil, a drug used to treat cognitive impairment in patients with Alzheimer's disease.</p>

<p>N-Methyl cyclophosphamide is an analog of the anticancer drug cyclophosphamide, which is used to treat various types of cancer. It works by inhibiting the activity of certain kinases that are involved in tumor growth and progression. N-Methyl cyclophosphamide has been shown to induce apoptosis in cancer cells, leading to their death. This medicinal compound can be used as a potent inhibitor of protein kinases, making it a promising candidate for developing new anticancer therapies. N-Methyl cyclophosphamide is excreted in urine and has been studied extensively in Chinese patients with different types of cancer. Its ability to inhibit kinase activity makes it a promising tool for developing targeted therapies against a variety of cancers.</p>

<p>Robenidine-d8 is a Chinese analog of Robenidine, an inhibitor of tumor growth in humans. It has been shown to have potent anticancer activity against various types of cancer cells, including those found in the urine and elastin tissues. Robenidine-d8 works by inhibiting kinases and proteins that are involved in cell division, leading to apoptosis or programmed cell death. This drug is also considered a promising candidate for cancer therapy due to its ability to inhibit the growth of tumors in animal models. Additionally, Robenidine-d8 has been found to act as a kinase inhibitor, which may contribute to its anticancer properties.</p>

<p>2-Ethylhexyl 4-[methyl(nitroso)amino]benzoate is an anticancer agent that has shown promising results in inhibiting tumor growth. It works by selectively targeting cancer cells and inducing apoptosis, or programmed cell death, which helps to prevent the spread of cancer cells. This compound has been found to inhibit the activity of certain proteins involved in regulating the cell cycle, which can help to slow down cancer cell growth. In addition, it has been shown to be a potent inhibitor of vitamin D receptor (VDR) activity, which is important for preventing the development of certain types of cancer. This compound has also demonstrated strong anticancer activity against various human cancer cell lines, including Chinese hamster ovary cells and urinary bladder carcinoma cells. Overall, 2-Ethylhexyl 4-[methyl(nitroso)amino]benzoate shows great potential as a powerful inhibitor of tumor growth and a promising candidate for future anticancer</p>

<p>Artemisinic aldehyde is a naturally occurring compound that has been shown to have potent anticancer properties. It induces apoptosis, or programmed cell death, in human cancer cells by inhibiting the activity of protein kinases. This compound has been used in traditional Chinese medicine for centuries and has recently gained attention as a potential cancer treatment. Artemisinic aldehyde is an inhibitor of tumor growth and can be used as a medicinal agent to treat various types of cancer. Studies have shown that this compound can inhibit the cell cycle and induce apoptosis in cancer cells, making it a promising candidate for further research. Additionally, artemisinic aldehyde has been found in urine samples from patients with heparin-induced thrombocytopenia, indicating its potential use as a diagnostic marker for this condition.</p>

<p>Purified recombinant Human CARD18 Protein (His tag)</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of FGFR1OP antibody, catalog no. 70R-4399</p>

<p>Purified Rabbit polyclonal MOT4 antibody</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of FAM134B antibody, catalog no. 70R-1786</p>

<p>The RhoA antibody is a powerful tool used in Life Sciences research. It specifically targets RhoA, a small GTPase protein that plays a crucial role in various cellular processes. This monoclonal antibody has been extensively tested and validated for its specificity and sensitivity.</p>

<p>CD20 antibody was raised in mouse using human CD20 as the immunogen.</p>

<p>Purified recombinant EXOSC4 protein (His tag)</p>

<p>Please enquire for more information about 1-NBD-decanoyl-2-decanoyl-sn-glycerol including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Propafenone-d5 hydrochloride including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Efaproxiral-d6 including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Purified Rabbit polyclonal MYBPC1 antibody</p>

<p>EML2 antibody was raised in Rabbit using Human EML2 as the immunogen</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of DNAJB9 antibody, catalog no. 70R-7401</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of ARL8B antibody, catalog no. 70R-3527</p>

<p>Rabbit polyclonal VATPase G1 antibody (biotin)</p>

<p>Kanamycin-OVA</p>

<p>Purified Polyclonal CUX1 antibody</p>

<p>Mouse monoclonal STAT4 antibody</p>

<p>The SMARCB1 antibody is a highly specialized test substance used for immunohistochemical detection. It is a monoclonal antibody that specifically targets SMARCB1, an inhibitory factor involved in the regulation of pluripotent cells. This antibody has been extensively studied and proven to be effective in detecting SMARCB1 expression in various tissues and cell types.</p>

<p>6-Fluoro-3-indoxyl-beta-D-galactopyranoside:<br>Enhance your tuberculosis treatment with 6-Fluoro-3-indoxyl-beta-D-galactopyranoside, an antituberculosis drug from the rifamycins class. This powerful compound exhibits bactericidal activity against tuberculosis infection, making it an essential addition to your medication regimen. By binding to DNA-dependent RNA polymerase, 6-Fluoro-3-indoxyl-beta-D-galactopyranoside inhibits bacterial growth by preventing transcription and replication. Its efficacy has been demonstrated through transcription-quantitative polymerase chain reactions and patch-clamp techniques. Metabolized through various transformations, this drug specifically targets Mycobacterium tuberculosis strains, inhibiting cell growth in culture. Trust 6-Fluoro-3-indoxyl-beta-D-galactopyranoside for effective and targeted treatment of tuberculosis infection.</p>

<p>P2Y2 antibody was raised in rabbit using a synthetic peptide comprising internal residues of the human P2Y2 protein as the immunogen.</p>

<p>Vasohibin 1 antibody was raised using the middle region of VASH1 corresponding to a region with amino acids SVPTFQPSTPVPERLEAVQRYIRELQYNHTGTQFFEIKKSRPLTGLMDLA</p>

<p>GPR52 antibody was raised in rabbit using a synthetic peptide conjugated to KLH as the immunogen.</p>

<p>Rabbit anti-dog IgG (Rhodamine) was raised in rabbit using canine IgG F(c) fragment as the immunogen.</p>

<p>Rabbit polyclonal cMet antibody (Tyr1003)</p>

<p>The Connexin 26 antibody is a highly effective biomolecule used in Life Sciences research. It is a polyclonal antibody that specifically targets and neutralizes the Connexin 26 protein, which plays a crucial role in cell communication. This antibody is widely used to study various cellular processes, including the regulation of glucagon secretion, autoantibody production, and the function of glycoproteins and steroids. Additionally, this monoclonal antibody has been proven to be effective in detecting and studying other biomolecules such as collagen, myelin-associated glycoprotein, interferon, and basic proteins. Researchers rely on the Connexin 26 antibody for its high specificity and reliability in their studies.</p>

<p>The E Cadherin antibody is a monoclonal antibody that specifically targets E-cadherin, a cell adhesion molecule involved in various cellular processes such as growth factor signaling and β-catenin regulation. This antibody is widely used in life sciences research to study the role of E-cadherin in different biological systems.</p>

<p>E2F7 antibody was raised in rabbit using the N terminal of E2F7 as the immunogen</p>

<p>EXOSC2 antibody was raised using the N terminal of EXOSC2 corresponding to a region with amino acids RKPLSERLGRDTKKHLVVPGDTITTDTGFMRGHGTYMGEEKLIASVAGSV</p>

<p>Rabbit polyclonal GPRASP1 antibody</p>

<p>The JAK1 antibody is a powerful tool in the field of life sciences. It specifically targets and inhibits the Janus kinase 1 (JAK1) enzyme, which plays a crucial role in various cellular processes including signal transduction, immune response, and cell growth. This antibody has been extensively studied and proven to be effective in blocking the activation of JAK1, thereby modulating downstream signaling pathways.</p>

<p>TMEM38A antibody was raised using the N terminal of TMEM38A corresponding to a region with amino acids GEPLIDYFSNNSSILLASAVWYLIFFCPLDLFYKCVCFLPVKLIFVAMKE</p>

<p>Rabbit polyclonal IKK alpha antibody</p>

<p>ASF antibody is a highly specialized antibody that is used in various life sciences applications. It has the ability to selectively bind to specific lectins and peptide hormones, allowing for precise detection and analysis. The ASF antibody has been extensively used in crystallization studies, where it aids in the formation of protein complexes for structural determination. It is also commonly employed in immunological assays to detect the presence of ASF in blood plasma and human serum samples. Additionally, this antibody has shown neutralizing activity against colony-stimulating factors and can be utilized in nuclear extract preparations for research purposes. Overall, the ASF antibody is a valuable tool for scientists working in diverse fields such as cell biology, immunology, and biochemistry.</p>

<p>Mouse monoclonal CD49e antibody (biotin)</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of AMY2B antibody, catalog no. 70R-10395</p>

<p>Mouse monoclonal Placental Protein 14 antibody</p>

<p>Rabbit polyclonal PHGDH antibody (biotin)</p>

<p>The Beta actin antibody is a highly versatile and essential tool in Life Sciences research. This monoclonal antibody specifically targets fibrinogen, an activated protein involved in blood clotting. By binding to fibrinogen, the Beta actin antibody can effectively neutralize its activity, making it a valuable tool for studying the role of fibrinogen in various biological processes.</p>

<p>SPNS1 antibody was raised using a synthetic peptide corresponding to a region with amino acids AGSDTAPFLSQADDPDDGPVPGTPGLPGSTGNPKSEEPEVPDQEGLQRIT</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of PPM1B antibody, catalog no. 70R-2682</p>