Biochemicals and Reagents
Biochemicals and reagents are fundamental substances for research and development in fields such as biotechnology, molecular biology, pharmacology, and medicine. These products are essential for a variety of applications, including compound synthesis, biological sample analysis, metabolic process research, and drug production. At CymitQuimica, we offer a wide selection of high-quality, high-purity biochemicals and reagents suitable for various scientific and industrial needs. Our catalog includes enzymes, antibodies, nucleic acids, amino acids, and many other products, all designed to support researchers and professionals in their research and development projects, ensuring reliable and reproducible results.
Subcategories of "Biochemicals and Reagents"
- Biomolecules(98,557 products)
- By Biological Target(101,014 products)
- By Pharmacological Effects(6,941 products)
- Cryopreservatives(21 products)
- Desinfectants and Related Compounds(28 products)
- Hormones(530 products)
- Plant Biology(6,903 products)
- Secondary Metabolites(14,371 products)
Found 130589 products of "Biochemicals and Reagents"
Sort by
Purity (%)
0
100
|
0
|
50
|
90
|
95
|
100
EIF2S3 antibody
EIF2S3 antibody was raised using the N terminal of EIF2S3 corresponding to a region with amino acids AGGEAGVTLGQPHLSRQDLTTLDVTKLTPLSHEVISRQATINIGTIGHVARUVBL2 antibody
RUVBL2 antibody was raised using a synthetic peptide corresponding to a region with amino acids IDRPATGTGSKVGKLTLKTTEMETIYDLGTKMIESLTKDKVQAGDVITID
ZNF596 antibody
ZNF596 antibody was raised in rabbit using the C terminal of ZNF596 as the immunogenPurity:Min. 95%RPL5 antibody
RPL5 antibody was raised using the N terminal of RPL5 corresponding to a region with amino acids RLVIQDKNKYNTPKYRMIVRVTNRDIICQIAYARIEGDMIVCAAYAHELPSLC30A8 antibody
SLC30A8 antibody was raised using a synthetic peptide corresponding to a region with amino acids LLIDLTSFLLSLFSLWLSSKPPSKRLTFGWHRAEILGALLSILCIWVVTGPurity:Min. 95%OR2L3 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of OR2L3 antibody, catalog no. 70R-9867Purity:Min. 95%LUC7L Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of LUC7L antibody, catalog no. 70R-9550Purity:Min. 95%DUSP9 antibody
The DUSP9 antibody is a powerful tool used in the field of Life Sciences for various applications. This antibody is specifically designed to target and bind to DUSP9, a protein that plays a crucial role in cellular signaling pathways. By binding to DUSP9, this antibody can effectively modulate the activity of this protein and regulate downstream processes.LDLRAD3 antibody
The LDLRAD3 antibody is a polyclonal antibody that specifically targets the LDLRAD3 protein. This protein is an acetyltransferase that plays a crucial role in various cellular processes. The antibody can be used in life sciences research to study the function and regulation of LDLRAD3.COPS4 antibody
COPS4 antibody was raised using a synthetic peptide corresponding to a region with amino acids YKLETYLKIARLYLEDDDPVQAEAYINRASLLQNESTNEQLQIHYKVCYA
DBH antibody
The DBH antibody is a highly specialized product in the field of Life Sciences. It is an antibody that specifically targets and binds to the tyrosine kinase receptor called tnf-α. This antibody has cytotoxic properties and can be used in various applications such as antibody-drug conjugates, growth factor assays, and protein-protein interaction studies.GCSF antibody
GCSF antibody was raised in rabbit using highly pure recombinant murine G-CSF as the immunogen.Purity:Min. 95%FAIM2 antibody
The FAIM2 antibody is a highly specialized biomarker that plays a crucial role in various biological processes. It is an essential component of the interferon signaling pathway and acts as a reductase for several proteins involved in immune responses. This polyclonal antibody is designed to specifically target and bind to FAIM2, allowing for accurate detection and analysis.IgM Isotype Control Fc fusion protein (allophycocyanin)
Rat monoclonal IgM Isotype Control Fc fusion protein (allophycocyanin)Purity:Min. 95%KIF20A antibody
The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is an antituberculosis drug that belongs to the rifamycins class. It is highly effective in treating tuberculosis infections as it possesses strong bactericidal activity. This drug works by binding to DNA-dependent RNA polymerase, which inhibits bacterial growth and prevents transcription and replication. Its potency has been demonstrated through patch-clamp technique experiments on human erythrocytes. The active form of this drug undergoes various metabolic transformations, including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, it specifically targets markers expressed in Mycobacterium tuberculosis strains and inhibits their cell growth in culture.C1GALT1 antibody
C1GALT1 antibody was raised using the middle region of C1GALT1 corresponding to a region with amino acids NVEAGDSRDTIGKETFHPFVPEHHLIKGYLPRTFWYWNYNYYPPVEGPGCPurity:Min. 95%LCK antibody
The LCK antibody is a monoclonal antibody that belongs to the class of antibodies. It has inhibitory properties against neurotrophic factors and tumor necrosis factor-alpha (TNF-α). This antibody specifically targets LCK, a protein kinase that plays a crucial role in T-cell activation and immune response. The LCK antibody can be used in various life science applications such as immunoassays, nuclear immobilization, and as an inhibitor for chemokine signaling pathways. It is highly specific and reliable, making it an essential tool for researchers in the field of immunology and molecular biology. With its high-quality production and performance, this antibody ensures accurate and reproducible results in your experiments.Purity:Min. 95%CHAC1 antibody
CHAC1 antibody was raised using a synthetic peptide corresponding to a region with amino acids TPQNPGYLGPAPEEAIATQILACRGFSGHNLEYLLRLADFMQLCGPQAQD
CENPH antibody
The CENPH antibody is a powerful tool used in various research applications, including interferon studies, cytotoxicity assays, and growth factor investigations. This monoclonal antibody specifically targets CENPH, a protein involved in cell division and chromosome segregation. By binding to CENPH, this antibody can help researchers understand the role of this protein in cellular processes.VPS16 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of VPS16 antibody, catalog no. 70R-9525
Purity:Min. 95%CD4 antibody
CD4 antibody was raised in rabbit using the C terminal of CD4 as the immunogenPurity:Min. 95%SARS-CoV-2 spike glycoprotein S1 protein
SARS-CoV-2 coronavirus spike glycoprotein S1 proteinPurity:Min. 95%RSBN1 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of RSBN1 antibody, catalog no. 70R-3871Purity:Min. 95%GOLGB1 antibody
GOLGB1 antibody was raised in mouse using recombinant Human Golgi Autoantigen, Golgin Subfamily B, Macrogolgin(With Transmembrane Signal), 1 (Golgb1)IMPA1 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of IMPA1 antibody, catalog no. 70R-3549Purity:Min. 95%TIM1 antibody
The TIM1 antibody is a monoclonal antibody that is used in the field of Life Sciences. It specifically targets and binds to TIM1, a growth factor receptor expressed on the surface of human cells. This antibody has been extensively studied for its role in autoimmune diseases and has shown potential as a therapeutic agent. The TIM1 antibody has been found to inhibit calcium binding and block the interaction between TIM1 and its ligands, thereby modulating cellular signaling pathways. Additionally, it has demonstrated cytotoxic effects on certain cell types and has been shown to promote mineralization in bone cells. With its high specificity and versatility, the TIM1 antibody is a valuable tool for researchers studying various aspects of cell biology and immunology.Mucin1 Antibody
The Mucin1 Antibody is a highly reactive monoclonal antibody that is used in various applications in the field of Life Sciences. This antibody is specifically designed to target and bind to Mucin1, a glycoprotein that plays a crucial role in cell adhesion and signaling.FTO antibody
The FTO antibody is a glycoprotein that acts as a growth factor and plays a crucial role in various cellular processes. It has been shown to be involved in glutamate signaling, cytotoxicity, diacylglycerol metabolism, and more. The FTO antibody is a monoclonal antibody that specifically targets and binds to the FTO protein, inhibiting its activity. This inhibition can have significant effects on cellular function and signaling pathways.BRS3 antibody
BRS3 antibody was raised in rabbit using a synthetic peptide conjugated to KLH as the immunogen.Purity:Min. 95%IDX 320
CAS:IDX 320 is a solid composition with the following characteristics:Formula:C37H43F3N6O7S2Purity:Min. 95%Molecular weight:804.9 g/molCD45R antibody
The CD45R antibody is a powerful tool used in the field of Life Sciences. It is a monoclonal antibody that specifically targets and binds to CD45R, a protein found on the surface of immune cells. This antibody has been extensively studied and proven to be highly effective in various research applications.
CD66a antibody
The CD66a antibody is a neutralizing monoclonal antibody that targets the p53 protein, a crucial regulator of cell growth and division. This antibody has been extensively studied in the field of Life Sciences and has shown promising results in inhibiting the activity of growth factors involved in cancer progression. Additionally, it has been found to modulate glucose-6-phosphate metabolism, protein synthesis, and ornithine decarboxylase activity. The CD66a antibody is widely used in biomaterials research and has also demonstrated its efficacy in blocking the activation of collagen-producing cells. With its specificity and potency, this monoclonal antibody is a valuable tool for researchers studying various cellular processes and exploring potential therapeutic interventions.Dasotraline
CAS:Dasotraline is a dopamine and norepinephrine reuptake inhibitor (DNRI), which is a small-molecule pharmaceutical developed for potential therapeutic use. This compound originates from synthetic chemical processes designed to modulate neurotransmitter activity within the central nervous system. The mode of action of dasotraline involves the inhibition of dopamine and norepinephrine transporters. By blocking the reuptake of these neurotransmitters, dasotraline increases their extracellular concentrations, thereby enhancing dopaminergic and noradrenergic signaling.Formula:C16H15Cl2NPurity:Min. 95%Molecular weight:292.2 g/molReal thiol
CAS:Real Thiol is a protein that is involved in the synthesis and processing of proteins. It binds to polyacrylamide, which is a substrate for the enzyme. Real Thiol's reactive nature can be seen in its redox signal, which is observed when it interacts with the oxidant dodecanethiol. This protein also has a disulfide bond that can be found in many specific proteins. The genome sequence of this protein has been determined and it has shown to be 11 amino acids long with one cysteine residue at position 3.
Formula:C20H17N3O7Purity:Min. 95%Molecular weight:411.4 g/molLY 2811376
CAS:Inhibitor of APP cleavage enzyme BACE1Formula:C15H14F2N4SPurity:Min. 95%Molecular weight:320.36 g/molGSK-1521498
CAS:GSK-1521498 is a new investigational drug that has been shown to reduce inflammation and oxidative stress in preclinical models. It targets multiple pathways, including the renin-angiotensin system, endoplasmic reticulum stress, and insulin signaling. In preclinical models, GSK-1521498 has been shown to reduce the prevalence of cancer and metabolic disorders such as type 2 diabetes. More research is needed to determine whether GSK-1521498 would be effective in humans.Formula:C24H20F2N4Purity:Min. 95%Molecular weight:402.4 g/molNeritaloside
CAS:Neritaloside is a cardiac glycoside that is classified as a depressant. It is used in the treatment of congestive heart failure and cardiac arrhythmias. Neritaloside has been shown to have neuroprotective effects, which may be due to its ability to inhibit reactive oxygen species and prevent DNA damage. Neritaloside also has been shown to have genotoxic effects, which can lead to cancer. Neritaloside binds to the α subunit of the adenosine receptor and inhibits protein synthesis, leading to cell death by inhibiting protein production vital for cell division. This drug also possesses some anticancer activity, which may be due to its ability to induce apoptosis in cultured cells.
Formula:C32H48O10Purity:Min. 95%Molecular weight:592.7 g/molN-Desboc docetaxel-d5
CAS:N-Desboc docetaxel-d5 is a deuterated analog of the chemotherapy drug docetaxel, which is derived from the diterpenoid taxane with a substitution at isotopic positions. This compound is synthesized to enhance the stability and traceability of docetaxel in biological systems during pharmacokinetic and metabolic studies. Its mode of action involves the inhibition of microtubule depolymerization, thus disrupting cell division and leading to apoptosis in rapidly dividing cancer cells.Formula:C38H45NO12Purity:Min. 95%Molecular weight:707.8 g/molPd 089828
CAS:Pd 089828 is a compound that inhibits the proliferation of cancer cells. It binds to receptors involved in the growth and metastasis of cancer cells, thereby inhibiting the binding of growth factors to their receptor. Pd 089828 has been shown to inhibit epidermal growth factor, which is a potent mitogen that stimulates cell division and inhibits apoptosis. This drug also has anticancer activity against breast cancer by blocking epidermal growth factor-induced cellular proliferation. It also shows anticancer activity in muscle cells by preventing muscle cell proliferation.Formula:C18H18Cl2N6OPurity:Min. 95%Molecular weight:405.3 g/molMitoebselen-2
CAS:Mitoebselen-2 is a peptide that is an activator of ion channels. It has been shown to inhibit the activity of protein interactions by binding to receptors and ligands. Mitoebselen-2 has been used in research as a tool for studying cell biology and pharmacology, as well as antibody production. Mitoebselen-2 has shown no adverse effects on mammals and can be used without restriction.Formula:C35H30ClN2O2PSePurity:Min. 95%Molecular weight:656.00 g/molAP2M1 antibody
The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is an antituberculosis drug that falls under the class of rifamycins. It is highly effective in treating tuberculosis infections. This active compound exhibits bactericidal activity by binding to DNA-dependent RNA polymerase, preventing transcription and replication. Extensive research has shown its potential through various techniques such as patch-clamp technique on human erythrocytes. Metabolically, it undergoes hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, it specifically targets markers expressed at high levels in Mycobacterium tuberculosis strains and inhibits cell growth in culture.LY2857785
CAS:LY2857785 is a potent and selective inhibitor of cyclin-dependent kinases 4 and 6 (CDK4/6). It inhibits the proliferation of cancer cells by interfering with cellular organelles, such as the mitochondria. LY2857785 has been shown to potently inhibit the proliferation of lymphocytic leukemia and fibrolamellar carcinoma cells. Inhibition of CDK4/6 activity leads to a decrease in transcriptional regulation, which may be due to an inhibition of cyclin D1 expression. The mechanism studies revealed that LY2857785 synergistically interacts with a number of inflammatory bowel disease drugs, including thalidomide and 5-aminosalicylic acid. This drug is effective against chronic lymphocytic leukemia at doses lower than those required for cancer treatment, making it a potential candidate for the prevention or treatment of this disease.Formula:C26H36N6OPurity:Min. 95%Molecular weight:448.6 g/molTTC8 antibody
TTC8 antibody was raised using the N terminal of TTC8 corresponding to a region with amino acids ENAIAQVPRPGTSLKLPGTNQTGGPSQAVRPITQAGRPITGFLRPSTQSGRBBP7 antibody
The RBBP7 antibody is a high-flux monoclonal antibody that is used in Life Sciences for various applications. It is commonly used as a serum marker and has antiviral properties. This antibody specifically targets RBBP7, an important protein involved in gene regulation and chromatin remodeling. By binding to RBBP7, this antibody can modulate its activity and affect cellular processes such as transcription and DNA repair. The RBBP7 antibody can be used in assays to study the expression and localization of RBBP7 in different cell types or tissues. Additionally, it has potential therapeutic applications as a medicament for diseases involving abnormal RBBP7 function. With its high specificity and affinity, the RBBP7 antibody is a valuable tool for researchers in the field of Life Sciences and offers promising opportunities for the development of targeted therapies and chemotherapy.Claudin Domain Containing 1 antibody
Claudin Domain Containing 1 antibody was raised using the middle region of CLDND1 corresponding to a region with amino acids TLTEQFMEKFVDPGNHNSGIDLLRTYLWRCQFLLPFVSLGLMCFGALIGLPurity:Min. 95%SPINT1 antibody
SPINT1 antibody was raised in rabbit using the C terminal of SPINT1 as the immunogenPurity:Min. 95%Factor XIIIA antibody
Factor XIIIA antibody is a monoclonal antibody used in the field of Life Sciences. It has antiviral properties and specifically targets carbonic molecules. This antibody can be used in various applications such as electrode development, colloidal chemistry, and chemokine research. Additionally, it has been proven effective in human serum electrophoresis studies, where it showed high affinity for alpha-fetoprotein and glycoproteins. Factor XIIIA antibody also exhibits natriuretic properties by targeting brain natriuretic peptide. With its specificity and versatility, this monoclonal antibody is an essential tool for researchers in the field of Life Sciences.NUP98 antibody
NUP98 antibody was raised in rabbit using the N terminal of NUP98 as the immunogenPurity:Min. 95%Human IgE protein
Human IgE protein is an important component of the immune system and plays a crucial role in allergic reactions. It is an immunoglobulin that binds to specific allergens, triggering the release of histamine and other inflammatory substances. Human IgE protein can be used in various applications, including research, diagnostics, and therapeutic interventions. Interferon is a type of cytokine that regulates the immune response against viral infections. Monoclonal antibodies are laboratory-produced molecules that can mimic the immune system's ability to fight off harmful pathogens. Autoantibodies are antibodies produced by the immune system that mistakenly target and attack healthy cells or tissues. Antiphospholipid antibodies are a type of autoantibody that targets phospholipids, leading to an increased risk of blood clots. Fatty acids are essential nutrients that play a crucial role in various physiological processes. Heparin-induced thrombocytopenia is a condition characterized by a decrease in platelet count due to an immunePurity:>95% By Sds-PageSLC19A3 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of SLC19A3 antibody, catalog no. 70R-7535
Purity:Min. 95%LSS antibody
LSS antibody was raised using a synthetic peptide corresponding to a region with amino acids TEGTCLRRRGGPYKTEPATDLGRWRLNCERGRQTWTYLQDERAGREQTGLRabbit anti Mouse IgG2a (biotin)
Rabbit anti-mouse IgG2a (biotin) was raised in rabbit using murine IgG2a heavy chain as the immunogen.Purity:Min. 95%PCDHA3 antibody
PCDHA3 antibody was raised using the N terminal of PCDHA3 corresponding to a region with amino acids LFSWREDPGAQCLLLSLLLLAASEVGSGQLHYSVSEEAKHGTFVGRIAQDPurity:Min. 95%FGFR1 antibody
The FGFR1 antibody is a highly specific monoclonal antibody that targets the FGFR1 protein, a key molecule involved in various cellular processes. This antibody recognizes specific amino acid residues on the FGFR1 protein and binds to it with high affinity. By binding to FGFR1, this antibody inhibits its activity and disrupts downstream signaling pathways.KCNQ2 antibody
KCNQ2 antibody was raised using the N terminal of KCNQ2 corresponding to a region with amino acids IDIMVLIASIAVLAAGSQGNVFATSALRSLRFLQILRMIRMDRRGGTWKLPurity:Min. 95%PCOLCE antibody
PCOLCE antibody was raised using the middle region of PCOLCE corresponding to a region with amino acids LLVQFVSDLSVTADGFSASYKTLPRGTAKEGQGPGPKRGTEPKVKLPPKSPurity:Min. 95%beta 2 Microglobulin antibody
Beta 2 microglobulin antibody was raised in rabbit using beta-2-microglobulin from human Urine as the immunogen.Purity:Min. 95%MAT2A antibody
MAT2A antibody was raised using the middle region of MAT2A corresponding to a region with amino acids LLEIVKKNFDLRPGVIVRDLDLKKPIYQRTAAYGHFGRDSFPWEVPKKLKRb antibody
The Rb antibody is a monoclonal antibody that specifically targets and binds to the Rb protein. This antibody is widely used in various assays and research applications in the field of Life Sciences. It has been extensively validated for use in nuclear staining, immunohistochemistry, and Western blotting. The Rb antibody offers high sensitivity and specificity, making it an ideal tool for studying the expression and localization of Rb protein in different tissues and cell types. Additionally, this antibody has been successfully used in studies involving human serum markers such as histamine, erythropoietin, sclerostin, glp-1, and human chorionic gonadotropin. With its superior performance and reliability, the Rb antibody is a valuable asset for researchers looking to unravel the intricate mechanisms underlying various biological processes.Purity:Min. 95%TAU antibody
The TAU antibody is a highly specialized monoclonal antibody that targets the growth factor known as acetylcholine. This antibody has been extensively studied in the field of Life Sciences and has shown promising results in various research areas. It specifically binds to interferon-gamma (IFN-gamma) and inhibits its activity, leading to a decrease in the production of chemokines and other inflammatory mediators.DBH antibody
The DBH antibody is a glycopeptide that belongs to the class of polyclonal antibodies. It specifically targets and binds to the glycoprotein known as dopamine beta-hydroxylase (DBH). DBH is an enzyme that plays a crucial role in the conversion of dopamine to norepinephrine, making it essential for proper neurotransmitter function.
FKBP1A protein
The FKBP1A protein is a versatile and important component in various biochemical processes. It can be used in research, diagnostics, and therapeutic applications. This protein has been extensively studied and characterized for its role in protein folding, cellular signaling, and immune response regulation.Purity:Min. 95%Mafk antibody
Mafk antibody was raised in rabbit using the N terminal of Mafk as the immunogenPurity:Min. 95%CISD2 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of CISD2 antibody, catalog no. 70R-6583Purity:Min. 95%14-3-3 zeta antibody
The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the class of rifamycins. It is highly effective in treating tuberculosis infections as it possesses strong bactericidal activity. This drug works by binding to DNA-dependent RNA polymerase, preventing transcription and replication, thereby inhibiting bacterial growth. The effectiveness of this drug has been demonstrated through extensive research using the patch-clamp technique on human erythrocytes. It undergoes various metabolic transformations, including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, 6-Fluoro-3-indoxyl-beta-D-galactopyranoside specifically targets markers expressed at high levels in Mycobacterium tuberculosis strains and effectively inhibits their growth in culture.
Purity:Min. 95%PRRC1 antibody
PRRC1 antibody was raised using the middle region of PRRC1 corresponding to a region with amino acids VGEAGQSNIAPQPVGYAAGLKGAQERIDSLRRTGVIHEKQTAVSVENFIATRIM27 antibody
TRIM27 antibody was raised in rabbit using the middle region of TRIM27 as the immunogenPurity:Min. 95%Chk1 antibody
The Chk1 antibody is a powerful tool in the field of molecular biology and research. This antibody specifically targets and binds to the Chk1 protein, which plays a crucial role in cell cycle regulation and DNA damage response. By inhibiting the activity of Chk1, this antibody can be used to study the effects of Chk1 inhibition on various cellular processes.Purity:Min. 95%CHN2 antibody
CHN2 antibody was raised using a synthetic peptide corresponding to a region with amino acids AFGVKVGVKGGFLWPPLKLFACSQISSLVRRAALTHNDNHFNYEKTHNFK
