Biochemicals and Reagents
Subcategories of "Biochemicals and Reagents"
- Biomolecules(98,557 products)
- By Biological Target(101,015 products)
- By Pharmacological Effects(6,941 products)
- Cryopreservatives(21 products)
- Desinfectants and Related Compounds(28 products)
- Hormones(530 products)
- Plant Biology(6,903 products)
- Secondary Metabolites(14,371 products)
Found 130589 products of "Biochemicals and Reagents"
DENND2C antibody
DENND2C antibody was raised using the middle region of DENND2C corresponding to a region with amino acids DIFESKRGKKKVKLHSYTGKELPPTKGETSGNESDAEYLPKNRHKRLAQLTBP antibody
The TBP antibody is a highly specialized product used in Life Sciences research. It is an acidic polyclonal antibody that specifically targets the TATA-binding protein (TBP). This antibody is commonly used in various assays and techniques such as hybridization, ELISA, and immunoblotting.GABRQ antibody
GABRQ antibody was raised using a synthetic peptide corresponding to a region with amino acids KFHFEFSSAVPEVVLNLFNCKNCANEAVVQKILDRVLSRYDVRLRPNFGGPurity:Min. 95%MAK10 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of MAK10 antibody, catalog no. 70R-2946Purity:Min. 95%TOP2A antibody
The TOP2A antibody is a highly specialized product in the field of Life Sciences. It belongs to the category of monoclonal antibodies and is specifically designed to target and inhibit the activity of TOP2A, an enzyme involved in DNA replication and repair processes. This antibody has been extensively studied and proven to effectively block the action of TOP2A, making it a valuable tool for researchers studying various biological pathways.C4ORF33 antibody
C4ORF33 antibody was raised using the C terminal Of C4Orf33 corresponding to a region with amino acids PNVTKFNSFAIHGSKDKRSYEALYPVPQHELQQGQKPDFHCLEYFKSFNFCEACAM3 antibody
CEACAM3 antibody was raised in rabbit using the C terminal of CEACAM3 as the immunogenPurity:Min. 95%GAPDH Blocking Peptide
The GAPDH Blocking Peptide is a highly effective peptide that belongs to the category of Peptides and Biochemicals. It is specifically designed to block the activity of glyceraldehyde 3-phosphate dehydrogenase (GAPDH), a key enzyme involved in glycolysis. By inhibiting the function of GAPDH, this blocking peptide can effectively prevent the binding of monoclonal antibodies to extracellular histones, thereby reducing their cytotoxic effects.Purity:Min. 95%Cytokeratin 6 antibody
Cytokeratin 6 antibody was raised in mouse using cytokeratin 6 of human callus cytoskeletal preparation as the immunogen.HBP1 antibody
HBP1 antibody was raised in rabbit using the middle region of HBP1 as the immunogenPurity:Min. 95%GCLC antibody
GCLC antibody was raised in rabbit using the middle region of GCLC as the immunogenPurity:Min. 95%ATF2 antibody
The ATF2 antibody is a monoclonal antibody commonly used in Life Sciences research. It specifically targets and binds to ATF2, a protein involved in various cellular processes such as gene regulation and DNA repair. The antibody has been extensively tested for its high specificity and sensitivity in detecting ATF2 in different experimental settings.PPP1R8 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of PPP1R8 antibody, catalog no. 70R-1468Purity:Min. 95%Clusterin-Like 1 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of CLUL1 antibody, catalog no. 70R-3976Purity:Min. 95%Slc9a3r2 antibody
Slc9a3r2 antibody was raised in rabbit using the N terminal of Slc9a3r2 as the immunogenPurity:Min. 95%TGFBR3 antibody
The TGFBR3 antibody is a valuable tool in the field of Life Sciences. It specifically targets the monophosphate growth factor receptor, TGFBR3, and can be used for various applications such as immunohistochemistry, western blotting, and flow cytometry. This antibody recognizes annexin A2, a marker peptide that plays a crucial role in cell signaling pathways. With its high specificity and sensitivity, the TGFBR3 antibody is an essential diagnostic reagent for researchers studying cellular processes related to nucleotide-binding domains and polymerase chain reactions. Additionally, this antibody has shown neuroprotective properties and may have potential as a therapeutic medicament. Its ability to form molecular weight complexes with adenosine receptor antagonists suggests its involvement in chloride transport regulation. The TGFBR3 antibody is a versatile tool that holds great promise for advancing scientific research in various fields.Fosteabine
CAS:Please enquire for more information about Fosteabine including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormula:C27H50N3O8PPurity:Min. 95%Molecular weight:575.7 g/molPRDX5 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of PRDX5 antibody, catalog no. 70R-5755Purity:Min. 95%Goat anti Monkey IgG (Alk Phos)
Goat anti-monkey IgG (Alk Phos) was raised in goat using monkey IgG gamma chain as the immunogen.Purity:Min. 95%SDF4 antibody
SDF4 antibody was raised using the middle region of SDF4 corresponding to a region with amino acids KTHFRAVDPDGDGHVSWDEYKVKFLASKGHSEKEVADAIRLNEELKVDEEPurity:Min. 95%TMEM82 antibody
TMEM82 antibody was raised using the N terminal of TMEM82 corresponding to a region with amino acids LETVHLAGLALFLTVVGSRVAALVVLEFSLRAVSTLLSLGKGSQGAAERLPurity:Min. 95%FAM82C antibody
FAM82C antibody was raised using the middle region of Fam82C corresponding to a region with amino acids LSATVEDALQSFLKAEELQPGFSKAGRVYISKCYRELGKNSEARWWMKLAPurity:Min. 95%RAD23A Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of RAD23A antibody, catalog no. 70R-1037
Purity:Min. 95%Rat Serum Albumin
Rat Serum Albumin is a highly versatile protein that plays a crucial role in various biological processes. It is commonly used in Life Sciences research, particularly in studies involving serum albumin binding, erythropoietin, monoclonal antibody production, and nuclear imaging. This native protein is also utilized in the field of neurobiology to investigate amyloid plaque formation and low-density lipoprotein metabolism.Purity:>95% By Sds-Page.Rabbit anti Goat IgG (rhodamine)
Rabbit antigoat IgG (Rhodamine) was raised in rabbit using goat IgG F(ab')2 fragment as the immunogen.Purity:Min. 95%MCM8 antibody
MCM8 antibody was raised using the N terminal of MCM8 corresponding to a region with amino acids RFIPYKGWKLYFSEVYSDSSPLIEKIQAFEKFFTRHIDLYDKDEIERKGSPurity:Min. 95%Ezrin antibody
The Ezrin antibody is a reactive mouse monoclonal antibody that is used in Life Sciences research. It can be detected using the chemiluminescence method and is highly specific for its target. This antibody has been extensively tested and validated for use in various applications, including enzyme labeling, particle chemiluminescence, and transcription-polymerase chain reaction (PCR). It has also been shown to specifically bind to neurokinin-1 receptor, making it a valuable tool for studying this protein. Additionally, the Ezrin antibody has been used in studies involving ascorbic acid and has demonstrated excellent performance. Whether you're conducting basic research or developing diagnostic assays, this monoclonal antibody will provide reliable and reproducible results. Trust the Ezrin antibody for your scientific endeavors.GPI protein (His tag)
1-558 amino acids: MGSSHHHHHH SSGLVPRGSH MAALTRDPQF QKLQQWYREH RSELNLRRLF DANKDRFNHF SLTLNTNHGH ILVDYSKNLV TEDVMRMLVD LAKSRGVEAA RERMFNGEKI NYTEGRAVLH VALRNRSNTP ILVDGKDVMP EVNKVLDKMK SFCQRVRSGD WKGYTGKTIT DVINIGIGGS DLGPLMVTEA LKPYSSGGPR VWYVSNIDGT HIAKTLAQLN PESSLFIIAS KTFTTQETIT NAETAKEWFL QAAKDPSAVA KHFVALSTNT TKVKEFGIDP QNMFEFWDWV GGRYSLWSAI GLSIALHVGF DNFEQLLSGA HWMDQHFRTT PLEKNAPVLL ALLGIWYINC FGCETHAMLP YDQYLHRFAA YFQQGDMESN GKYITKSGTR VDHQTGPIVW GEPGTNGQHA FYQLIHQGTK MIPCDFLIPV QTQHPIRKGL HHKILLANFL AQTEALMRGK STEEARKELQ AAGKSPEDLE RLLPHKVFEG NRPTNSIVFT KLTPFMLGAL VAMYEHKIFV QGIIWDINSF DQWGVELGKQ LAKKIEPELD GSAQVTSHDA STNGLINFIK QQREARVQPurity:Min. 95%OLIG3 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of OLIG3 antibody, catalog no. 70R-8453Purity:Min. 95%SPTLC1 antibody
SPTLC1 antibody was raised using the middle region of SPTLC1 corresponding to a region with amino acids ICPLPELVKLKYKYKARIFLEESLSFGVLGEHGRGVTEHYGINIDDIDLIPurity:Min. 95%(R)-5-Fluoro-N-(4-fluoro-3-(3-imino-2,5-dimethyl-1,1-dioxido-1,2,4-thiadiazinan-5-yl)phenyl)picolinamide 2,2,2-trifluoroacetate
CAS:(R)-5-Fluoro-N-(4-fluoro-3-(3-imino-2,5-dimethyl-1,1-dioxido-1,2,4-thiadiazinan-5-yl)phenyl)picolinamide 2,2,2-trifluoroacetate is a sophisticated chemical compound, primarily utilized in the field of pharmaceutical research. Derived from synthetic organic chemical processes, this compound represents a class of advanced heteroaryl amides with potential bioactive properties. Its unique mode of action is centered on its ability to engage in binding interactions, presumably with specific protein targets or enzymes, influencing molecular pathways related to disease states.
Formula:C19H18F5N5O5SPurity:Min. 95%Molecular weight:523.4 g/molFGR antibody
The FGR antibody is a highly specialized antibody that targets extracellular histones and acts as a growth factor. It has the unique ability to neutralize human folate, making it an essential tool in research and medical applications. This antibody also plays a crucial role in detecting alpha-fetoprotein and autoantibodies, providing valuable insights into various diseases and conditions. Additionally, the FGR antibody can inhibit interferon activity, making it an excellent candidate for therapeutic use. With its wide range of applications in life sciences and the study of chemokines, this polyclonal antibody is a versatile tool for researchers and scientists alike.Goat anti Mouse IgG + IgA + IgM (H + L) (rhodamine)
Goat anti-mouse IgG/IgA/IgM (H+L) (Rhodamine) was raised in goat using Mouse IgG, IgA, IgM whole molecules as the immunogen.Purity:Min. 95%p73 antibody
The p73 antibody is a type of antibody that specifically targets the p73 protein. It is an autoantibody, meaning it is produced by the body's immune system in response to the presence of p73. This antibody has been shown to play a role in various biological processes, including the formation of amyloid plaques and the regulation of cell growth and development.CRYAB antibody
The CRYAB antibody is a highly sensitive protein detection tool that utilizes colloidal gold-labeled monoclonal antibodies. This antibody specifically targets the CRYAB protein, which is involved in various cellular processes. It can be used for ultrasensitive detection of CRYAB in different samples, including human serum and tissue lysates. The CRYAB antibody is immobilized on an electrode, allowing for easy and efficient detection. Additionally, this antibody has neutralizing capabilities, making it suitable for functional studies of CRYAB. Whether you are conducting research in the field of life sciences or developing diagnostic assays, the CRYAB antibody is an essential tool for accurate and reliable protein detection.HIST3H3 antibody
HIST3H3 antibody was raised in rabbit using the N terminal of HIST3H3 as the immunogenUNC5C antibody
UNC5C antibody was raised using a synthetic peptide corresponding to a region with amino acids VVVALFVYRKNHRDFESDIIDSSALNGGFQPVNIKAARQDLLAVPPDLTSPurity:Min. 95%DPF1 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of DPF1 antibody, catalog no. 70R-8033
Purity:Min. 95%IFIT5 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of IFIT5 antibody, catalog no. 70R-5819Purity:Min. 95%GTPBP9 antibody
GTPBP9 antibody was raised using a synthetic peptide corresponding to a region with amino acids MIGPIIDKLEKVAVRGGDKKLKPEYDIMCKVKSWVIDQKKPVRFYHDWND
Tfdp1 antibody
Tfdp1 antibody was raised in rabbit using the N terminal of Tfdp1 as the immunogenPurity:Min. 95%Carbonic anhydrase protein
Carbonic anhydrase protein is a vital component of the body's enzyme system. It plays a crucial role in maintaining the pH balance and regulating various physiological processes. This protein has been extensively studied in Life Sciences and has shown promising results in various applications.Purity:Min. 95%RIPX antibody
RIPX antibody was raised in rabbit using the C terminal of RIPX as the immunogenPurity:Min. 95%HAAO Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of HAAO antibody, catalog no. 70R-2592Purity:Min. 95%EGFR antibody
The EGFR antibody is a highly effective monoclonal antibody that specifically targets the epidermal growth factor receptor (EGFR). It is designed to bind to the EGFR protein and inhibit its activity, thereby preventing the growth and proliferation of cancer cells. This antibody has been extensively studied in the field of life sciences and has shown promising results in various preclinical and clinical trials.Purity:Min. 95%TSHR Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of TSHR antibody, catalog no. 70R-1187Purity:Min. 95%1,2-Dipalmitoyl-d62-sn-glycero-3-phosphocholine-N,N,N-trimethyl-d9
CAS:Controlled Product1,2-Dipalmitoyl-d62-sn-glycero-3-phosphocholine-N,N,N-trimethyl-d9 is a deuterated phospholipid, which is an important tool in biophysical research. This molecule is sourced from the synthetic modification of natural phosphatidylcholine, incorporating deuterium atoms to enhance its utility in specialized studies. The deuterium labeling replaces hydrogen atoms, which significantly reduces background noise and enhances signal clarity in spectroscopic techniques like NMR and neutron scattering.Formula:C40H9NO8PD71Purity:Min. 95%Molecular weight:805.48 g/molPHKG2 antibody
PHKG2 antibody was raised using a synthetic peptide corresponding to a region with amino acids EDELPDWAAAKEFYQKYDPKDVIGRGVSSVVRRCVHRATGHEFAVKIMEVEPHX1 antibody
EPHX1 antibody was raised using a synthetic peptide corresponding to a region with amino acids CPSIPGYGFSEASSKKGFNSVATARIFYKLMLRLGFQEFYIQGGDWGSLI
Purity:Min. 95%SPINT2 protein
The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug classified under rifamycins. It is specifically designed to combat tuberculosis infections by targeting active compounds that exhibit bactericidal activity. This drug works by binding to DNA-dependent RNA polymerase, preventing transcription and replication of the bacteria. Extensive research has been conducted on its human activity using the patch-clamp technique on human erythrocytes. Metabolically, it undergoes various transformations like hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, it selectively binds to markers expressed at high levels in Mycobacterium tuberculosis strains, inhibiting cell growth in culture.Purity:Min. 95%RASSF1 antibody
RASSF1 antibody was raised in rabbit using the C terminal of RASSF1 as the immunogenPurity:Min. 95%OXCT1 antibody
OXCT1 antibody was raised using the middle region of OXCT1 corresponding to a region with amino acids GMYANLGIGIPLLASNFISPNITVHLQSENGVLGLGPYPRQHEADADLINPurity:Min. 95%GABARAP antibody
GABARAP antibody was raised in rabbit using Residues 15-31 [RSEGEKIRKKYPDRVPV] of the GABARAP protein as the immunogen.Purity:Min. 95%TRIM37 antibody
TRIM37 antibody was raised using the middle region of TRIM37 corresponding to a region with amino acids GMSSDSDIECDTENEEQEEHTSVGGFHDSFMVMTQPPDEDTHSSFPDGEQmolecular weight (Uniprot) is 108kDa
Progesterone
Progesterone is a steroid hormone that acts as a nuclear receptor in the body. It plays a crucial role in various physiological processes, including the menstrual cycle and pregnancy. Progesterone can be measured in blood plasma using immunoassays, such as flow assays, which utilize monoclonal antibodies specific to progesterone. These antibodies bind to progesterone molecules, allowing for accurate measurement of progesterone concentration. Synthetic progesterone analogs have also been developed for use in research and medical applications. Additionally, surface modification techniques can be employed to immobilize monoclonal antibodies on solid supports, enabling the development of robust and sensitive progesterone detection systems. Overall, progesterone is a vital hormone with diverse functions and its measurement is essential in various fields, including Life Sciences and clinical diagnostics.Purity:Min. 95%TrkA antibody
The TrkA antibody is a highly specialized monoclonal antibody that targets the growth factor receptor TrkA. This receptor plays a crucial role in cell growth, survival, and differentiation. By binding to the virus surface antigen, the TrkA antibody effectively inhibits the activation of this receptor, preventing abnormal cell growth and proliferation.ZNF565 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of ZNF565 antibody, catalog no. 70R-8994Purity:Min. 95%MAPKAPK2 antibody
MAPKAPK2 antibody was raised in rabbit using the middle region of MAPKAPK2 as the immunogen
