Biochemicals and Reagents

<p>The CD1d antibody is a highly specialized monoclonal antibody that has neutralizing properties. It is commonly used in the field of Life Sciences for various applications, including immobilization on electrodes, detection of human serum markers, and inhibition of endothelial growth. This monoclonal antibody exhibits antiangiogenic effects by targeting specific markers involved in blood vessel formation.</p>

<p>Mouse monoclonal Bt Cry1Ab/Ac antibody</p>

<p>CYP26B1 antibody was raised using the middle region of CYP26B1 corresponding to a region with amino acids SRFELATRTFPRITLVPVLHPVDGLSVKFFGLDSNQNEILPETEAMLSAT</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of LIX1 antibody, catalog no. 70R-3596</p>

<p>Dopamine Transporter Monoclonal Antibody (HRP)</p>

<p>Mouse monoclonal RALBP1 antibody</p>

<p>Rabbit polyclonal ZFYVE9 antibody</p>

<p>Purified recombinant PSMD11 protein (His tag)</p>

<p>The SST antibody is a monoclonal antibody that specifically targets amyloid plaques, which are protein clumps commonly associated with neurodegenerative diseases such as Alzheimer's. This antibody has been extensively used in Life Sciences research to study the formation and progression of these plaques. In addition to its use in research, the SST antibody can also be used in diagnostic applications for detecting the presence of amyloid plaques in patient samples. It has shown high specificity and sensitivity when tested against various forms of amyloid proteins. Furthermore, the SST antibody has demonstrated anti-angiogenesis properties, making it a potential therapeutic option for diseases characterized by abnormal blood vessel growth. With its ability to bind to low-molecular-weight compounds and activated surfaces, this antibody is a versatile tool for studying protein interactions and developing new treatments.</p>

<p>Purified recombinant GCHFR protein (His tag)</p>

<p>ApoBEC3D antibody was raised using a synthetic peptide corresponding to a region with amino acids SYTWLCYEVKIKRGRSNLLWDTGVFRGPVLPKRQSNHRQEVYFRFENHAE</p>

<p>Purified recombinant MED27 protein (His tag)</p>

<p>Pou4f3 antibody was raised in rabbit using the N terminal of Pou4f3 as the immunogen</p>

<p>COLEC12 antibody was raised using the N terminal of COLEC12 corresponding to a region with amino acids AISTNSELSTFRSDILDLRQQLREITEKTSKNKDTLEKLQASGDALVDRQ</p>

<p>The Catalase antibody is a powerful tool used in various research applications. It is available in both polyclonal and monoclonal forms, providing researchers with options based on their specific needs. This antibody is highly specific and has been extensively validated for use in immunoassays.</p>

<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the class of rifamycins. It is specifically designed to combat tuberculosis infections by targeting the active compounds responsible for bactericidal activity. This drug works by binding to DNA-dependent RNA polymerase, preventing transcription and replication, ultimately inhibiting bacterial growth. Rigorous testing using the patch-clamp technique on human erythrocytes has revealed its high efficacy in combating tuberculosis. Additionally, it undergoes various metabolic transformations, including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Notably, it also exhibits specific binding to markers expressed at high levels in Mycobacterium tuberculosis strains and effectively inhibits cell growth in culture.</p>

<p>Rabbit polyclonal RNF212 antibody</p>

<p>Rabbit polyclonal PYGB antibody (biotin)</p>

<p>The OLIG2 antibody is a monoclonal antibody that specifically targets the TGF-beta protein. It has been extensively tested and proven to effectively neutralize the activity of TGF-beta in human serum. This antibody is widely used in Life Sciences research for various applications, including immunohistochemistry, western blotting, and flow cytometry.</p>

<p>Mouse monoclonal CD40 antibody (PE)</p>

<p>Purified Polyclonal NSG2 antibody</p>

<p>Recombinant human IL-1beta</p>

<p>1-210 amino acids: MRGSHHHHHH GMASMTGGQQ MGRDLYDDDD KDRWGSHMPP YTVVYFPVRG RCAALRMLLA DQGQSWKEEV VTVETWQEGS LKASCLYGQL PKFQDGDLTL YQSNTILRHL GRTLGLYGKD QQEAALVDMV NDGVEDLRCK YISLIYTNYE AGKDDYVKAL PGQLKPFETL LSQNQGGKTF IVGDQISFAD YNLLDLLLIH EVLAPGCLDA FPLLSAYVGR LSARPKLKAF LASPEYVNLP INGNGKQ</p>

<p>PPAR gamma-2 antibody was raised in rabbit using a synthetic peptide corresponding to residues M(1) G E T L G D S P I D P E S D S(16) C of human PPAR gamma-2.</p>

<p>GSTM5 antibody was raised using the N terminal of GSTM5 corresponding to a region with amino acids MPMTLGYWDIRGLAHAIRLLLEYTDSSYVEKKYTLGDAPDYDRSQWLNEK</p>

<p>Rabbit polyclonal STARD3NL antibody</p>

<p>GHRHR antibody was raised using the N terminal of GHRHR corresponding to a region with amino acids VTLPCPDFFSHFSSESGAVKRDCTITGWSEPFPPYPVACPVPLELLAEEE</p>

<p>Betaxolol HCL (USP grade powder) chemical reference substance</p>

<p>Recombinant Human CDK5RAP3 protein with His tag</p>

<p>NOC4L antibody was raised using a synthetic peptide corresponding to a region with amino acids CRVLVHRPHGPELDADPYDPGEEDPAQSRALESSLWELQALQRHYHPEVS</p>

<p>MACF1 antibody was raised in Rabbit using Human MACF1 as the immunogen</p>

<p>The ACTB antibody is a monoclonal antibody used in the field of Life Sciences. It specifically targets and binds to ACTB, which stands for Actin Beta, an important protein involved in cellular processes such as cell movement and structure. This antibody has been shown to have inhibitory effects on interferon, a signaling molecule involved in the immune response.</p>

<p>Normal Council Serum is a versatile product with various applications in the field of Life Sciences and Veterinary medicine. It contains isothiocyanate, which has been shown to have antimicrobial properties against pneumococcus. Additionally, Normal Council Serum contains annexin, an important protein involved in cellular processes such as apoptosis and cell signaling. This serum can be used in Veterinary Applications for the detection and quantification of oncostatin levels. It can also be used as a research tool for the development of inhibitors, antibodies, and monoclonal antibodies targeting specific proteins such as growth hormone receptor or nuclear annexin A2. Furthermore, Normal Council Serum is pegylated, which enhances its stability and prolongs its half-life in the body. Its unique formulation makes it an ideal choice for various applications in both the Life Sciences and Veterinary fields.</p>

<p>Sulphachlorpyridazine Conjugate for use in immunoassays</p>

<p>Recombinant Human ACTR3 protein</p>

<p>CYP4X1 antibody was raised using the middle region of CYP4X1 corresponding to a region with amino acids LDIVLSAKDESGSSFSDIDVHSEVSTFLLAGHDTLAASISWILYCLALNP</p>

<p>SpUlp1 antibody was raised in rabbit using residues 7-20 of the SpUlp1 protein as the immunogen.</p>

<p>Mouse monoclonal MTMR14 antibody</p>

<p>Chymotrypsin C antibody was raised using a synthetic peptide corresponding to a region with amino acids LGITVLAALLACASSCGVPSFPPNLSARVVGGEDARPHSWPWQISLQYLK</p>

<p>GRPEL1 antibody was raised using a synthetic peptide corresponding to a region with amino acids NSGQNLEEDMGQSEQKADPPATEKTLLEEKVKLEEQLKETVEKYKRALAD</p>

<p>HEPH antibody was raised in Rabbit using Human HEPH as the immunogen</p>

<p>Rabbit polyclonal SH3GL2 antibody</p>

<p>CD44 Monoclonal Antibody (RPE)</p>

<p>Purified recombinant SCL70 protein</p>

<p>The Caspase 3 antibody is a highly specific monoclonal antibody that is widely used in Life Sciences research. It is designed to target and detect the activity of caspase enzymes, which play a crucial role in programmed cell death (apoptosis). This antibody has been extensively validated for its specificity and sensitivity.</p>

<p>Mouse monoclonal DYNC1LI1 antibody</p>

<p>BLNK antibody was raised using the middle region of BLNK corresponding to a region with amino acids QYALGRKKNGEEYFGSVAEIIRNHQHSPLVLIDSQNNTKDSTRLKYAVKV</p>

<p>The alpha Synuclein antibody is a powerful tool used in life sciences research. This monoclonal antibody specifically targets and binds to alpha Synuclein, a protein associated with neurodegenerative diseases such as Parkinson's disease. By targeting this protein, the antibody allows researchers to study its role in the development and progression of these diseases.</p>

<p>MAP3K2 antibody was raised using the N terminal of MAP3K2 corresponding to a region with amino acids AERKKRLSIIGPTSRDRSSPPPGYIPDELHQVARNGSFTSINSEGEFIPE</p>

<p>Purified recombinant M6PR protein (His tag)</p>

<p>Rabbit polyclonal SRA1 antibody</p>

<p>Mouse monoclonal LEMD3 antibody</p>

<p>Heme Oxygenase antibody was raised using a synthetic peptide corresponding to a region with amino acids ERPQPDSMPQDLSEALKEATKEVHTQAENAEFMRNFQKGQVTRDGFKLVM</p>

<p>Rabbit polyclonal alpha Synuclein antibody (Tyr125)</p>

<p>NPY1R antibody was raised in rabbit using a 15 amino acid peptide from mouse NPY1R as the immunogen.</p>

<p>Rabbit polyclonal SRPRB antibody</p>

<p>Purified Polyclonal ADRB2 antibody</p>

<p>ERBB4 antibody was raised in rabbit using a synthetic peptide conjugated to KLH as the immunogen.</p>

<p>The TST antibody is a polyclonal antibody that has been developed as an anti-connexin agent. It is designed to target connexins, which are proteins involved in cell communication. This antibody has been extensively tested and shown to be highly effective in neutralizing connexin activity.</p>

<p>Fa2h antibody was raised in rabbit using the C terminal of Fa2h as the immunogen</p>

<p>PDE1C antibody was raised using the middle region of PDE1C corresponding to a region with amino acids IDFIVEPTFTVLTDMTEKIVSPLIDETSQTGGTGQRRSSLNSISSSDAKR</p>

<p>HAO1 antibody was raised using a synthetic peptide corresponding to a region with amino acids GLNGILVSNHGARQLDGVPATIDVLPEIVEAVEGKVEVFLDGGVRKGTDV</p>

<p>Mouse monoclonal ERAS antibody</p>

<p>The MAOA antibody is a polyclonal antibody used in Life Sciences research and immunoassays. It specifically targets the monoamine oxidase A enzyme, which plays a crucial role in the metabolism of neurotransmitters such as serotonin, dopamine, and norepinephrine. This antibody is reactive and neutralizing, meaning it can bind to MAOA and inhibit its activity.</p>

<p>PRLHR antibody was raised in rabbit using a synthetic peptide conjugated to KLH as the immunogen.</p>

<p>GMFB antibody was raised in Rabbit using Human GMFB as the immunogen</p>

<p>This antibody reacts with heavy chains on human IgG (gamma chain).</p>

<p>PSA antibody was raised in Mouse using a purified recombinant fragment of KLK3 (aa26-251) expressed in E. coli as the immunogen.</p>

<p>The Androgen Receptor antibody is a highly specialized product used in Life Sciences research. It is designed to target and detect the androgen receptor, a protein that plays a crucial role in the regulation of epidermal growth factor signaling pathways. This antibody is produced using state-of-the-art techniques, ensuring high specificity and sensitivity.</p>

<p>GNA15 antibody was raised using the N terminal of GNA15 corresponding to a region with amino acids ARSLTWRCCPWCLTEDEKAAARVDQEINRILLEQKKQDRGELKLLLLGPG</p>

<p>Rabbit polyclonal SLC25A34 antibody</p>

<p>The FOXO4 antibody is a highly specialized protein that plays a crucial role in various biological processes. It specifically binds to FOXO4, a transcription factor involved in regulating gene expression. This antibody has been extensively studied and proven to be effective in immunoassays, making it an essential tool for researchers in the field of life sciences.</p>

<p>Purified recombinant CEACAM7 protein (His tag)</p>

<p>SLC35E2 antibody was raised using the middle region of SLC35E2 corresponding to a region with amino acids AAASDRRSPVPPSERHGVRPHGENLPGDFQVPQALHRVALSMALPCPMLP</p>

<p>Troponin I antibody was raised in mouse using human troponin I as the immunogen.</p>

<p>Rat monoclonal B7DC antibody (biotin)</p>

<p>GPR15 antibody was raised in rabbit using a synthetic peptide conjugated to KLH as the immunogen.</p>

<p>RHBDL2 antibody was raised using a synthetic peptide corresponding to a region with amino acids KWMLPEKSRGTYLERANCFPPPVFIISISLAELAVFIYYAVWKPQKQWIT</p>

<p>GAA antibody was raised using the N terminal of GAA corresponding to a region with amino acids FGVIVRRQLDGRVLLNTTVAPLFFADQFLQLSTSLPSQYITGLAEHLSPL</p>

<p>LY 309887 is a synthetic analog of the natural compound LY315920. It has significant cytotoxicity in prostate cancer cells and leukemia cells. LY 309887 also inhibits cell growth in l1210 murine cells by blocking the ATP synthesis, which is required for cell division. It may also be effective against autoimmune diseases due to its ability to inhibit macrophage inflammatory activity and decrease tumor xenografts. The biochemical mechanism of action for LY 309887 is unknown at this time.</p>

<p>Purified recombinant Human TK2 protein (His tag)</p>

<p>The TLR4 antibody is a highly effective product in the field of Life Sciences. It is specifically designed to neutralize tumor necrosis factor-alpha (TNF-α) and has been extensively tested in human serum. This antibody also has the ability to inhibit the activity of transforming growth factor-beta (TGF-beta), alpha-fetoprotein, phalloidin, and creatine kinase. With its neutralizing properties, it effectively targets collagen and glycoprotein, making it an ideal choice for researchers working with actin filaments and electrodes. The TLR4 antibody is a polyclonal antibody that guarantees accurate and reliable results for your experiments.</p>

<p>H6PD antibody was raised in Rabbit using Human H6PD as the immunogen</p>

<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is an antituberculosis drug that falls under the class of rifamycins. It is highly effective in treating tuberculosis infections due to its bactericidal activity. By binding to DNA-dependent RNA polymerase, it inhibits bacterial growth, preventing transcription and replication. This drug has been extensively studied using the patch-clamp technique on human erythrocytes, confirming its high efficacy. Its active form undergoes various metabolic transformations, including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, it specifically targets markers expressed at high levels in Mycobacterium tuberculosis strains, inhibiting cell growth in culture.</p>

<p>Disarib is a potent inhibitor of protein kinases that has demonstrated anticancer activity in preclinical studies. It is an analog of the toxin disarcidin, which is isolated from the Chinese medicinal plant Hydractinia echinata. Disarib induces apoptosis in human cancer cells by inhibiting the activity of kinases involved in cell growth and survival pathways. This compound has also shown promising results as a tumor growth inhibitor in animal models. Disarib can be detected in urine samples after administration, which makes it a viable candidate for clinical development as an anticancer drug. Its unique mechanism of action and potent inhibition of kinases make it a promising option for future cancer therapies.</p>

<p>Rabbit polyclonal UGCG antibody</p>

<p>MAP3K7IP1 antibody was raised in Rabbit using Human MAP3K7IP1 as the immunogen</p>

<p>The FANCA antibody is a highly specialized polyclonal antibody used in the field of life sciences. It is designed to target and bind to the FANCA protein, which is involved in various cellular processes such as insulin-like growth factor signaling and DNA repair. This antibody has been extensively studied and proven to be effective in research related to trastuzumab, alpha-synuclein, and other proteins.</p>

<p>The Methyltestosterone antibody is a specific antibody used in various assays to detect and measure the presence of Methyltestosterone in human serum. It utilizes an agglutination assay principle, where the antigen-antibody reaction leads to the formation of visible clumps or aggregates. This antibody is derived from polyclonal antibodies, which are produced by immunizing animals with Methyltestosterone conjugated to a carrier protein.</p>

<p>Uromodulin antibody was raised using the middle region of UMOD corresponding to a region with amino acids MTNCYATPSSNATDPLKYFIIQDRCPHTRDSTIQVVENGESSQGRFSVQM</p>

<p>Rabbit polyclonal TRIP6 antibody</p>

<p>Mouse monoclonal OSBPL11 antibody</p>

<p>Synaptogyrin 2 antibody was raised using the N terminal of SYNGR2 corresponding to a region with amino acids ESGAYGAAKAGGSFDLRRFLTQPQVVARAVCLVFALIVFSCIYGEGYSNA</p>

<p>The Cry1 antibody is a monoclonal antibody that has neutralizing properties against the interferon-galectin-3-binding complex. This antibody specifically targets and binds to the Cry1 protein produced by Bacillus thuringiensis, inhibiting its endocytic uptake into cells. The Cry1 antibody also has a high affinity for fatty acids and collagen, making it an effective agent for blocking their interaction with target molecules. Additionally, this monoclonal antibody has been shown to inhibit phosphatase activity and reduce low-density lipoprotein (LDL) levels in vitro. With its versatile properties, the Cry1 antibody holds great potential for therapeutic applications in various fields of research and medicine.</p>

<p>C20orf149 antibody was raised in Rabbit using Human C20orf149 as the immunogen</p>

<p>Rabbit polyclonal PFKFB2 antibody</p>

<p>ITPK1 antibody was raised using the middle region of ITPK1 corresponding to a region with amino acids NAIQPPCVVQNFINHNAVLYKVFVVGESYTVVQRPSLKNFSAGTSDRESI</p>

<p>Mouse monoclonal PRPH antibody</p>

<p>TOLLIP antibody was raised using the C terminal of TOLLIP corresponding to a region with amino acids MATTVSTQRGPVYIGELPQDFLRITPTQQQRQVQLDAQAAQQLQYGGAVG</p>

<p>JUB antibody was raised in Rabbit using Human JUB as the immunogen</p>