Biochemicals and Reagents

<p>1,2-Dimyristoyl-sn-glycero-3-phosphocholine-N,N,N-trimethyl-d9 is a deuterium-labeled phospholipid, which is a synthetic construct designed for biochemical research. This compound is sourced through chemical synthesis, where specific hydrogen atoms in the molecule are replaced with deuterium, enhancing its utility in specialized analytical techniques. The deuterium labeling facilitates the compound's use in nuclear magnetic resonance (NMR) spectroscopy, as it reduces background proton signals and enhances resolution.</p>

<p>PSP antibody was raised in mouse using recombinant human PSP (1-225aa) purified from E. coli as the immunogen.</p>

<p>M8-B hydrochloride is a monoclonal antibody that binds to the extracellular domain of the cation channel (TRPA1) and inhibits its activity. It has been shown to inhibit spontaneous pain in mice with neuropathic pain and inflammatory pain. M8-B hydrochloride also blocks TRPA1 activity in prostate cancer cells, which are used as an experimental model for prostate cancer.</p>

<p>LAT antibody is a monoclonal antibody that specifically targets amyloid plaque, which is a hallmark of various neurodegenerative diseases. It has been shown to have cytotoxic effects on amyloid-beta peptide, the main component of these plaques. LAT antibody works by binding to the amyloid-beta peptide and promoting its clearance from the brain.</p>

<p>TTC-352 is a small molecule that selectively modulates the activity of certain ion channels. It is an inhibitor of the Kv1.3 channel, which is expressed in neurons and dorsal root ganglion cells. TTC-352 has been shown to inhibit neuronal activity and to be an effective analgesic when used in combination with morphine. TTC-352 has also been shown to have anticancer properties as an inhibitor of epidermal growth factor receptor (EGFR) signaling and as a potential treatment for metastatic melanoma. The ligand binds to the receptor, preventing it from binding to its natural ligands, inhibiting downstream signaling pathways. This inhibition leads to cell death by apoptosis or necrosis depending on the type of cancer cell.</p>

<p>Rabbit polyclonal BSK3 antibody</p>

<p>Gephyrin antibody was raised using the N terminal of GPHN corresponding to a region with amino acids HDELEDLPSPPPPLSPPPTTSPHKQTEDKGVQCEEEEEEKKDSGVASTED</p>

<p>The p53 antibody is a highly specialized antibody that is capable of detecting and binding to the p53 protein. This protein plays a crucial role in regulating cell growth and preventing the formation of tumors. The p53 antibody is specifically designed to target and bind to the activated form of the p53 protein, making it an invaluable tool for researchers studying cancer and other diseases.</p>

<p>U91356 is an agonist of the nicotinic acetylcholine receptor. It is a potent inhibitor of ACh-activated currents in rat sympathetic neurons, and also inhibits potassium-evoked currents in rat hippocampal neurons. U91356 is a competitive antagonist at the alpha3beta4 nicotinic acetylcholine receptor, but does not inhibit responses to ACh or nicotine in mice with alpha7 nicotinic acetylcholine receptor deficiency.</p>

<p>Rabbit polyclonal EEF1G antibody</p>

<p>Inhibitor of Aurora kinase</p>

<p>Affinity purified rabbit CYBB antibody</p>

<p>KIN antibody was raised in Rabbit using Human KIN as the immunogen</p>

<p>PDPN antibody was raised in mouse using recombinant human PDPN (1-206aa) purified from E. coli as the immunogen.</p>

<p>PSMB2 antibody was raised using a synthetic peptide corresponding to a region with amino acids LDRYYTPTISRERAVELLRKCLEELQKRFILNLPTFSVRIIDKNGIHDLD</p>

<p>Purified recombinant MINA protein (His tag)</p>

<p>BLZ 945 is a novel small molecule that inhibits the activation of microglia, which are immune cells in the brain. It has been shown to inhibit tumor growth and radiation-induced tissue damage in cancer research. BLZ 945 also reduces the severity of autoimmune diseases by inhibiting the production of pro-inflammatory cytokines such as csf-1r and toll-like receptor 4. In addition, it has anti-inflammatory properties due to its inhibition of macrophage migration and adhesion. The drug has been shown to reduce the size of solid tumours in mice by reducing tumor angiogenesis and inhibiting cell proliferation.</p>

<p>Recombinant Human CYP2E1 protein (His tag)</p>

<p>SLC45A2 antibody was raised using the C terminal of SLC45A2 corresponding to a region with amino acids IGWTAFLSNMLFFTDFMGQIVYRGDPYSAHNSTEFLIYERGVEVGCWGFC</p>

<p>PJ34 is a chemical compound that induces apoptosis in cancer cells. It has been shown to induce caspase-independent cell death in myeloma cells and HL-60 leukemia cells, but not in normal cells. PJ34 is a selective inhibitor of PARP-1, an enzyme that regulates the balance between DNA repair and apoptosis. This drug also induces neuronal death by inhibiting basic proteins without inducing necrosis.</p>

<p>Recombinant Human Novel Coronavirus Spike glycoprotein(S),partial</p>

<p>TNFRSF10B antibody is a polyclonal antibody that specifically targets the TNFRSF10B protein. This protein is found in the nucleus and adipose tissues and plays a crucial role in various biological processes. The TNFRSF10B antibody is designed to neutralize the activity of TNFRSF10B, making it an essential tool for research in the life sciences field.</p>

<p>Asp 2535 is a sodium hypochlorite-based compound, which is a chlorine-releasing agent with potent antimicrobial properties. It originates from the oxidation of sodium chloride and displays its efficacy through the release of hypochlorous acid upon dissolution in water. This mode of action involves the disruption of essential cellular processes in microorganisms, including protein synthesis and nucleic acid structure, ultimately leading to cell death.</p>

<p>ZNF200 antibody was raised in rabbit using the middle region of ZNF200 as the immunogen</p>

<p>Please enquire for more information about Dihydro nicotyrine-d3 including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>YHO-13177 is a novel chemotherapeutic drug that is being investigated for its effectiveness against cancer. YHO-13177 has been shown to inhibit the ATP binding cassette transporter, which prevents the export of nucleotides from cells and inhibits DNA synthesis. It also inhibits cancer cell proliferation in a dose-dependent manner and has been shown to be effective against murine leukemia. YHO-13177 has been shown to bind to human cervical carcinoma cells, but not to healthy cells, suggesting that it may have potential as a treatment for cervical cancer.</p>

<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug from the rifamycin class. It is specifically designed to combat tuberculosis infections by targeting active compounds and exhibiting bactericidal activity. This drug works by binding to DNA-dependent RNA polymerase, preventing transcription and replication of bacteria. It has been extensively studied using advanced techniques like the patch-clamp technique on human erythrocytes. The active form of this drug undergoes various metabolic transformations, such as hydrolysis, oxidation, reduction, and conjugation. Additionally, it binds to markers expressed in Mycobacterium tuberculosis strains and inhibits their growth in culture.</p>

<p>AZD 8186 is a selective small-molecule inhibitor, which is sourced from synthesized chemical compounds, specifically designed to target the phosphoinositide 3-kinase (PI3K) pathway. This inhibitor functions by selectively inhibiting the PI3K isoforms, primarily PI3Kβ and PI3Kδ, which play critical roles in multiple cell signaling pathways related to growth, survival, and proliferation.</p>

<p>N2,N2-Dimethyl-N6-(1-oxododecyl)-L-lysine is a peptide and an inhibitor of ion channels. It was originally isolated from the venom of the Brazilian spider Phoneutria nigriventer. N2,N2-Dimethyl-N6-(1-oxododecyl)-L-lysine binds to voltage gated sodium channels, inhibiting the opening of these channels. This inhibition prevents the propagation of action potentials, and leads to a cessation in neural activity. N2,N2-Dimethyl-N6-(1-oxododecyl)-L-lysine also inhibits potassium channels by binding to the S4 region of these channels. The inhibition of potassium channels leads to hyperpolarization and a decrease in neural activity.</p>

<p>Rabbit Polyclonal Vimentin antibody (Ser83)</p>

<p>4-(4-Bromo-phenyl)-1-(5-methoxy-1H-indol-3-ylmethyl)-piperidin-4-ol is a potent and selective activator of the human TRPA1 receptor. It has been shown to activate the channel and induce calcium influx in human embryonic kidney cells. This compound can also be used as a research tool to study protein interactions and pharmacology. The purity of this product is high, with no detectable impurities. 4-(4-Bromo-phenyl)-1-(5-methoxy-1H-indol-3-ylmethyl)-piperidin-4 -ol is available for purchase from Sigma Aldrich at CAS No. 8734456044.</p>

<p>Rabbit polyclonal WRKY62.2 antibody</p>

<p>LIN7C antibody was raised using a synthetic peptide corresponding to a region with amino acids MGGKEQNSPIYISRIIPGGIADRHGGLKRGDQLLSVNGVSVEGEHHEKAV</p>

<p>XPNPEP2 antibody was raised using a synthetic peptide corresponding to a region with amino acids QALLKASHVRDAVAVIRYLVWLEKNVPKGTVDEFSGAEIVDKFRGEEQFS</p>

<p>Mycoplasma pneumoniae protein is a neutralizing protein that plays a crucial role in combating infections caused by Mycoplasma pneumoniae. This protein has been extensively studied and is known for its ability to inhibit the growth of Mycoplasma pneumoniae, a common respiratory pathogen. It acts by binding to specific receptors on the surface of the bacteria, preventing their attachment and subsequent invasion of host cells.</p>

<p>Mouse monoclonal GABPB2 antibody</p>

<p>Cacng8 antibody was raised in rabbit using the middle region of Cacng8 as the immunogen</p>

<p>Rabbit polyclonal XRCC3 antibody</p>

<p>Clenbuterol-BSA</p>

<p>APP antibody was raised using the middle region of APP corresponding to a region with amino acids EAKHRERMSQVMREWEEAERQAKNLPKADKKAVIQHFQEKVESLEQEAAN</p>

<p>The POU2F1 antibody is a highly specialized antibody that targets the POU2F1 protein. This protein plays a crucial role in various biological processes, including cell growth, differentiation, and development. The antibody specifically recognizes and binds to the POU2F1 protein, allowing for its detection and analysis in various experimental settings.</p>

<p>2,2-Methylenebis(4-bromophenol) is an analog of inhibitors that target protein kinases. This compound has shown potential as a medicinal anticancer agent due to its ability to induce apoptosis in human cancer cells. It inhibits the cell cycle and tumor growth in Chinese hamster ovary (CHO) cells. Additionally, 2,2-Methylenebis(4-bromophenol) has been found to be excreted in urine and may have diagnostic potential for detecting cancer. Its mechanism of action involves the inhibition of protein kinases, which are involved in various cellular processes such as signal transduction and cell division. This compound holds promise as a potential therapeutic agent for cancer treatment.</p>

<p>Please enquire for more information about FGTI-2734 including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of ARMCX6 antibody, catalog no. 70R-1805</p>

<p>Sulfo-SPDB is a lysine analog that has potent antitumor activity and is being evaluated as a potential cancer therapeutic agent. It inhibits tumor growth in vitro by inhibiting the expression of proteins important for cell division and survival. Sulfo-SPDB binds to the lysine residues on the surface of cells, including erythrocytes, lymphocytes, and tumor cells. This binding prevents protein synthesis and cell division. In vivo studies have shown that sulfo-SPDB is effective against human liver cancer xenografts in mice, cervical cancer xenografts in mice, and t-cell lymphoma xenografts in mice. Clinical studies are underway to determine if it is safe for use in humans.</p>

<p>Rat monoclonal CD24 antibody (PE)</p>

<p>Please enquire for more information about N-(2-Azidoethyl)betulonamide including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Purified recombinant CCL3 protein (His tag)</p>

<p>Halofuginone Conjugate for use in immunoassays</p>

<p>Purified recombinant LRRC59 protein (His tag)</p>

<p>Cathepsin B protein is a versatile enzyme that plays a crucial role in various biological processes. It is commonly used in research and diagnostic applications. Cathepsin B protein can be easily activated using an electrode or other suitable methods. It is often used in studies involving human serum, where it helps to understand the mechanisms of certain diseases. Monoclonal antibodies specific to Cathepsin B protein are available, which enable researchers to study its functions and interactions with other proteins. Recombinant proteins of Cathepsin B are also widely used in various experiments and assays.</p>

<p>ML337 is a functional ligand that binds to the metabotropic glutamate receptor subtype 2 (mGlu2). It has been shown to be an allosteric modulator of mGlu2, where it acts as an agonist at low concentrations and as a negative allosteric modulator at high concentrations. ML337 has been shown to inhibit calcium-sensing receptor function in renal cells and may have potential for the treatment of chronic kidney diseases.</p>

<p>Rat monoclonal CIRE antibody (biotin)</p>

<p>MLS6585 is a functional allosteric modulator of the dopamine D2 receptor. It has been shown to increase the affinity and inhibitory effect of dopamine at the D2 receptor. MLS6585 was found to have a significant effect on neuronal function in rats, reversing dyskinesia and improving motor function. This drug also reduced blood pressure and had an anti-inflammatory effect in mice. MLS6585 is currently being developed as a treatment for Parkinson's disease, depression, and hypertension.</p>

<p>K 114 is a selective herbicide, which is a synthetic chemical intervention designed to target and manage unwanted plant species in agricultural settings. Derived from advanced chemical synthesis processes, it ensures high purity and efficacy in real-world applications. The mode of action involves the inhibition of key enzymatic pathways crucial for the survival and growth of broadleaf and grassy weeds, thereby effectively hindering their development without affecting the desired crops.</p>

<p>SR 13800 is a nutritional supplement that contains branched-chain amino acids. It is used to help transport the active substances into muscle cells. This supplement has been shown to increase the uptake of amino acids by mammalian cells in culture and has an oral bioavailability of 100%. SR 13800 is not currently available in any other form besides a powder. It can be dissolved in water and consumed as a drink, or mixed with food. The product does not contain any other ingredients besides amino acids and does not require refrigeration.</p>

<p>Rabbit polyclonal KLHDC2 antibody</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of MYOZ1 antibody, catalog no. 70R-2197</p>

<p>Tead4 antibody was raised in rabbit using the middle region of Tead4 as the immunogen</p>

<p>Purified recombinant PRRT2 protein (His tag)</p>

<p>Sheep polyclonal Flunixin antibody</p>

<p>Toxoplasma gondii protein is a versatile and essential component in the field of Life Sciences. This protein exhibits various characteristics that make it highly valuable for research purposes. It possesses epidermal growth factor properties, making it an excellent candidate for studying cellular growth and development. Additionally, Toxoplasma gondii protein has been found to have neutralizing effects, which can be utilized in the development of therapeutic interventions.</p>

<p>The nNOS antibody is a highly effective tool in the field of atypical hemolytic research. It is specifically designed to target and detect brucella abortus, a bacterium that causes serious infections in animals and humans. This antibody belongs to the class of polyclonal antibodies, which means it can recognize multiple epitopes on the target protein.</p>

<p>Olprinone is a drug that is used to treat congestive heart failure. It is an oral medication that works by decreasing the workload of the heart and improving blood flow, which reduces the strain on the heart. Olprinone also decreases the production of cytokines such as IL-10 and TNF-α, which are associated with inflammation. This drug has been shown to be effective for treatment of skin cancer in a low-dose group. The molecular docking analysis showed that olprinone binds to a cardiac response element (CRE) in signal pathways. Olprinone has also been shown to have anti-inflammatory properties in vitro and in animal models.</p>

<p>NDUFA9 antibody was raised using a synthetic peptide corresponding to a region with amino acids QLHHALMPHGKGGRSSVSGIVATVFGATGFLGRYVVNHLGRMGSQVIIPY</p>

<p>UBE2M antibody was raised using a synthetic peptide corresponding to a region with amino acids IKLFSLKQQKKEEESAGGTKGSSKKASAAQLRIQKDINELNLPKTCDISF</p>

<p>Purified Rabbit polyclonal EIF2AK1 antibody</p>

<p>Avilamycin Conjugate for use in immunoassays</p>

<p>Purified recombinant SIAH1 protein (His tag)</p>

<p>Purified Rabbit polyclonal ACVR1B antibody</p>

<p>The TFR2 antibody is a highly effective tool in antiestrogen therapy. It specifically targets the histamine H4 receptor, which plays a crucial role in estrogen signaling pathways. By blocking this receptor, the TFR2 antibody effectively inhibits the growth and proliferation of estrogen-dependent tumors.</p>

<p>MGSSHHHHHH SSGLVPRGSH MAEDADMRNE LEEMQRRADQ LADESLESTR RMLQLVEESK DAGIRTLVML DEQGEQLERI EEGMDQINKD MKEAEKNLTD LGKFCGLCVC PCNKLKSSDA YKKAWGNNQD GVVASQPARV VDEREQMAIS GGFIRRVTND ARENEMDENL EQVSGIIGNL RHMALDMGNE IDTQNRQIDR IMEKADSNKT RIDEANQRAT KMLGSG</p>

<p>3-AQC is a mitochondrial respiratory chain inhibitor that inhibits electron transport and the production of ATP. 3-AQC is taken up by mitochondria and functions in the respiratory chain. The drug has significant effects on cellular organelles, such as the cell membrane, and can be used to study mitochondrial functions. The drug was found to have significant effects on cardiomyocytes, leading to cardiac dysfunction in neonatal rats.</p>

<p>Rabbit polyclonal CK2A1 antibody (Tyr255)</p>

<p>Mouse monoclonal DPP9 antibody</p>

<p>RPL37A antibody was raised using the middle region of RPL37A corresponding to a region with amino acids CGKTKMKRRAVGIWHCGSCMKTVAGGAWTYNTTSAVTVKSAIRRLKELKD</p>

<p>FT827 is a small molecule that is a covalent inhibitor of ubiquitin ligases. FT827 inhibits the activity of the proteasome by inhibiting ubiquitin ligases and proteasome-dependent protein degradation. FT827 has been shown to inhibit cancer growth in organoids, as well as infection by Borrelia burgdorferi, an agent of Lyme disease. FT827 was also shown to inhibit the replication of rabies virus in vitro. The precise molecular mechanism of action for this drug remains unknown, but it may be due to its ability to inhibit ubiquitin ligases.<br>!--END--&gt;</p>

<p>Sheep polyclonal Sulphanitran antibody</p>

<p>Mouse monoclonal OMP28 antibody</p>

<p>Rabbit polyclonal Caspase 1 antibody (FITC)</p>

<p>Purified recombinant HOXC11 protein (His tag)</p>

<p>PFI-4 is a small molecule that has been shown to inhibit cancer cell growth and proliferation. It is a hydroxyl group analog that binds to the bromodomain of proteins in the cellular nucleus and blocks the interaction between acetylated histones and transcription factors. PFI-4 also inhibits virus replication, specifically influenza virus, by binding to the stem cell-like antigen. This drug is an optical imaging agent that can be used for optical imaging of cells with stem cell-like phenotypes. PFI-4 also inhibits tumor growth by disrupting the disulfide bond in water molecules.</p>

<p>Mouse monoclonal NT5DC1 antibody</p>

<p>Please enquire for more information about GSK 591 dihydrochloride including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>PIGQ antibody was raised using the N terminal of PIGQ corresponding to a region with amino acids PTVLPDRQAGATTASTGGLAAVFDTVARSEVLFRSDRFDEGPVRLSHWQS</p>

<p>Mac glucuronide phenol-linked SN-38 is a chemically engineered prodrug derived from irinotecan. This compound serves as a targeted therapeutic agent, designed to enhance the delivery and activation of SN-38, an active metabolite, at tumor sites. The source of this product arises from the selective conjugation of SN-38 with a glucuronide moiety, linked through a phenolic connector, enabling preferential release in the tumor microenvironment.</p>

<p>BMS-1001 hydrochloride is a peptide that is an activator of ion channels. It has been shown to inhibit the activation of potassium channels and calcium channels in rat brain slices. BMS-1001 hydrochloride also binds to the receptor site of human calcitonin gene-related peptide (CGRP) and blocks its binding to CGRP receptor sites on mast cells. This prevents the release of histamine, which is responsible for allergic reactions such as hay fever, asthma, and chronic urticaria.<br>BMS-1001 hydrochloride has been shown to be a potent inhibitor of protein interactions with ligands and receptors. It inhibits the interaction between human erythropoietin (EPO) and its receptor by competing with endogenous EPO for binding sites on the surface of erythrocytes.</p>

<p>Haptoglobin antibody was raised against Human Haptoglobin.</p>

<p>FSH antibody was raised in mouse using high purity intact FSH from human pituitary gland as the immunogen.</p>

<p>Purified Polyclonal MYST4 antibody</p>

<p>Rabbit polyclonal GPR92 antibody</p>

<p>Goat polyclonal Human Complement C4 antibody</p>

<p>The Keratin 18 antibody is a nanocomposite that consists of a DNA aptamer with an amino group. It can be used in Life Sciences research to study the growth factor and protein kinases involved in various cellular processes. The antibody specifically targets Keratin 18, which is a protein expressed in epithelial cells. This monoclonal antibody allows for the detection and visualization of Keratin 18 through an antigen-antibody reaction. It can be used in applications such as immunofluorescence staining, western blotting, and polymerase chain reactions (PCR). The Keratin 18 antibody is highly specific and sensitive, making it a valuable tool for researchers studying cellular biology and disease mechanisms.</p>

<p>Mouse monoclonal EFNA2 antibody</p>

<p>Mouse monoclonal Myosin antibody</p>

<p>Rabbit polyclonal COL4A1 antibody (HRP)</p>

<p>Purified recombinant JAM3 protein (His tag)</p>

<p>Rabbit polyclonal SPHK1 antibody</p>

<p>Inhibitor of pan-AKT</p>

<p>(E)-5-(4-Chlorophenyl)-3-phenylpent-2-enoic acid is an anti-inflammatory compound, which is synthesized through organic chemical processes. Its mode of action involves the inhibition of cyclooxygenase enzymes, thereby reducing the synthesis of pro-inflammatory mediators such as prostaglandins. This action is critical in diminishing inflammation and associated symptoms.</p>