Biochemicals and Reagents
Subcategories of "Biochemicals and Reagents"
- Biomolecules(98,557 products)
- By Biological Target(101,014 products)
- By Pharmacological Effects(6,941 products)
- Cryopreservatives(21 products)
- Desinfectants and Related Compounds(28 products)
- Hormones(530 products)
- Plant Biology(6,903 products)
- Secondary Metabolites(14,371 products)
Found 130589 products of "Biochemicals and Reagents"
Claudin 4 antibody
The Claudin 4 antibody is a highly effective polyclonal antibody that specifically targets Claudin 4, an important protein involved in cell adhesion and tight junction formation. This antibody has been extensively tested and validated for its specificity and sensitivity in various applications, including Western blotting, immunohistochemistry, and flow cytometry.
POU5F1 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of POU5F1 antibody, catalog no. 70R-8464Purity:Min. 95%METAP2 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of METAP2 antibody, catalog no. 70R-2897Purity:Min. 95%TMED1 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of TMED1 antibody, catalog no. 70R-7395Purity:Min. 95%CDC25C antibody
The CDC25C antibody is a polyclonal antibody that specifically targets the growth factor CDC25C. It is known to play a crucial role in cell cycle regulation and is primarily located on the apical membrane of cells. The CDC25C antibody can be used in various assays and experiments to detect and measure the levels of CDC25C protein. It is available as both polyclonal and monoclonal antibodies, providing researchers with options based on their specific needs. The CDC25C antibody has been widely used in studies related to hepatocyte growth, epidermal growth, human folate metabolism, collagen activation, and glycosylation processes. Additionally, it has been employed as an inhibitor of phosphatase activity in different experimental settings. With its high specificity and reliability, the CDC25C antibody is an essential tool for researchers studying cell cycle regulation and related pathways.
Purity:Min. 95%RAB35 antibody
RAB35 antibody was raised in rabbit using the middle region of RAB35 as the immunogen
Purity:Min. 95%Apolipoprotein A1 Light Tryptic Peptide Standard (4nmol)
Apolipoprotein A1 light tryptic peptide standard for protein identification and quantitation studies. Apolipoprotein A1 is a structural component of high density lipoprotein (HDL) and is involved in cellular cholesterol homeostasis and reverse cholesterol transport.Purity:Min. 95%Dynamin inhibitory peptide, myristoylated
CAS:Dynamin inhibitory peptide is a high purity, myristoylated peptide that inhibits dynamin. It is a research tool for studying the interactions of Dynamin with other proteins, ion channels, and receptors. The CAS number for this product is 251634-22-7.Formula:C61H107N19O14Purity:Min. 95%Molecular weight:1,330.6 g/molChlorogenic acid-13C6
CAS:Please enquire for more information about Chlorogenic acid-13C6 including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormula:C16H18O9Purity:Min. 95%Molecular weight:360.26 g/mol(±)-Cannabichromevarinic acid
CAS:(±)-Cannabichromevarinic acid is an analog of cannabichromene, a cannabinoid found in cannabis plants. It has been shown to have potential anticancer properties by inhibiting tumor growth and inducing apoptosis in cancer cells. This compound has also been found to inhibit kinase activity, which is involved in cell cycle regulation and proliferation. Studies have shown that (±)-Cannabichromevarinic acid can inhibit the growth of human cancer cells and may be a promising medicinal agent for the treatment of various types of cancer. Additionally, this compound has been detected in Chinese urine samples and may have potential as a protein inhibitor for cancer therapy.Formula:C20H26O4Purity:Min. 95%Molecular weight:330.4 g/molCyclin-Dependent Kinase Inhibitor 2A, human, recombinant
Cyclin-Dependent Kinase Inhibitor 2A (CDK2A) is a cyclin-dependent kinase inhibitor that inhibits the activity of cyclin-dependent kinases. CDK2A is a protein that belongs to the family of cyclin-dependent kinase inhibitors. It inhibits the activity of various cyclin-dependent kinases and prevents cell growth by suppressing protein synthesis. CDK2A is expressed in many human tissues, including erythrocytes, brain, heart, lung, muscle, pancreas, spleen, and testis. Cyclin-Dependent Kinase Inhibitor 2A can be used as an anti-cancer agent due to its ability to inhibit tumor proliferation.Purity:Min. 95%Recombinant EBV Capsid Antigen, p18
Please enquire for more information about Recombinant EBV Capsid Antigen, p18 including the price, delivery time and more detailed product information at the technical inquiry form on this page
Purity:Min. 95%Rotavirus Antigen
Please enquire for more information about Rotavirus Antigen including the price, delivery time and more detailed product information at the technical inquiry form on this pagePurity:Min. 95%Parvovirus B19 Antigen, Virus-Like Particles (VP2)
Parvovirus B19 Antigen, Virus-Like Particles (VP2), biologically engineered to mimic the virus’s outer shell, specifically VP2, a major capsid protein of Parvovirus.
Parvovirus is a single-stranded DNA virus that causes erythema infectiosum in children and arthritis-like symptoms in adults. In vulnerable populations such as pregnant women or immunocompromised individuals, it can cause serious complications like anaemia or hydrops fetails.
Parvovirus VP2 VLPs are commonly used as antigens in diagnostic serology assays to detect antibodies against Parvovirus B19 in patient samples. This antigen is also a useful research tools and can be used in vaccine research.Purity:Min. 95%Native HSV Type 2 Antigen
Please enquire for more information about Native HSV Type 2 Antigen including the price, delivery time and more detailed product information at the technical inquiry form on this pagePurity:Min. 95%Recombinant EBV Early Antigen p138
Please enquire for more information about Recombinant EBV Early Antigen p138 including the price, delivery time and more detailed product information at the technical inquiry form on this pagePurity:Min. 95%9-[4-[1-(Dimethylamino)propan-2-yl]phenyl]-8-hydroxy-5H-thieno[2,3-c]quinolin-4-one
CAS:9-[4-[1-(Dimethylamino)propan-2-yl]phenyl]-8-hydroxy-5H-thieno[2,3-c]quinolin-4-one is a peptide that is used as a research tool to study ion channels and protein interactions. It has been shown to inhibit the activity of voltage gated sodium channels in rat hippocampal neurons in vitro. 9-[4-[1-(Dimethylamino)propan-2-yl]phenyl]-8-hydroxy-5H-thieno[2,3-c]quinolin-4-one binds to the binding site of the receptor, which is located on the outside surface of cells or inside cell membranes.Formula:C22H22N2O2SPurity:Min. 95%Molecular weight:378.5 g/molBorrelia Afzelii Antigen
Please enquire for more information about Borrelia Afzelii Antigen including the price, delivery time and more detailed product information at the technical inquiry form on this pagePurity:Min. 95%Cytomegalovirus (CMV) EIA Antigen
Please enquire for more information about Cytomegalovirus (CMV) EIA Antigen including the price, delivery time and more detailed product information at the technical inquiry form on this page
Purity:Min. 95%Adenovirus Antigen
Please enquire for more information about Adenovirus Antigen including the price, delivery time and more detailed product information at the technical inquiry form on this pagePurity:Min. 95%Native HSV Type 1 Antigen
Please enquire for more information about Native HSV Type 1 Antigen including the price, delivery time and more detailed product information at the technical inquiry form on this pagePurity:Min. 95%Campylobacter Jejuni Antigen
Please enquire for more information about Campylobacter Jejuni Antigen including the price, delivery time and more detailed product information at the technical inquiry form on this page
Purity:Min. 95%Borrelia Garinii Antigen
Please enquire for more information about Borrelia Garinii Antigen including the price, delivery time and more detailed product information at the technical inquiry form on this pagePurity:Min. 95%Mycoplasma Pneumoniae Antigen
Mycoplasma pneumoniae is a bacterium that commonly causes respiratory tract infections in humans and is spread through respiratory droplets when an infected person coughs or sneezes. Symptoms can include a persistent dry cough, sore throat, fever, fatigue, and chest discomfort.
Unlike many other bacteria, it lacks a cell wall, which makes it naturally resistant to antibiotics such as penicillin and related β-lactam drugs. It therefore only responds to antibiotics that target protein synthesis (such as macrolides, tetracyclines, or fluoroquinolones).
This antigen can be used in research and for the development of diagnostic assays to diagnose Mycoplasma pneumoniae.Purity:Min. 95%Recombinant EBV Nuclear Antigen EBNA1, p72
Please enquire for more information about Recombinant EBV Nuclear Antigen EBNA1, p72 including the price, delivery time and more detailed product information at the technical inquiry form on this pagePurity:Min. 95%Recombinant EBV Early Antigen p54
Please enquire for more information about Recombinant EBV Early Antigen p54 including the price, delivery time and more detailed product information at the technical inquiry form on this pagePurity:Min. 95%8-Oxoguanine DNA Glycosylase, human, recombinant
8-Oxoguanine DNA glycosylase is a glycosylase enzyme that repairs the 8-oxoG DNA base. It has been purified from human and Escherichia coli cells and recombinantly produced in E. coli. The enzyme has a molecular mass of about 42 kDa and is composed of two polypeptide chains with an apparent molecular weight of 17 kDa each. 8-Oxoguanine DNA glycosylase has been shown to have a broad substrate range, including both oxidized and reduced forms of 8-oxoG, as well as other oxidized purine bases such as 7,8-dihydrothymine (8-hydroxyguanine) and 5,6-dihydrothymine (5,6-dihydroxyguanine). The enzyme catalyzes the removal of the damaged base from the DNA backbone without any concomitant chemical changes in the sugar or phosphate groupsPurity:Min. 95%Apolipoprotein B Light Tryptic Peptide Standard (4nmol)
An Apolipoprotein B light tryptic peptide standard for use in protein identification and quantitation studies. Apolipoprotein B is responsibly for carrying lipids such as low density lipoprotein (LDL), chylomicrons, intermediate-density lipoprotein, very low-density lipoprotein and lipoprotein (a).Purity:Min. 95%Recombinant EBV Capsid Antigen, p23
Please enquire for more information about Recombinant EBV Capsid Antigen, p23 including the price, delivery time and more detailed product information at the technical inquiry form on this pagePurity:Min. 95%Lipoxin B4 methyl ester
CAS:Lipoxin B4 methyl ester is a vitamin-like compound that has been found to have anticancer properties. This analog of Lipoxin B4 has been shown to induce apoptosis in cancer cells by inhibiting specific kinases and proteins involved in cell division. In addition, it has been found to be an inhibitor of urinary tumor growth in humans. Lipoxin B4 methyl ester has been studied extensively as a potential treatment for various cancers, including breast cancer and prostate cancer. It has also shown promising results as an inhibitor of Chinese hamster ovary cell proliferation. The use of Lipoxin B4 methyl ester may represent a new approach to the treatment of cancer and other diseases associated with abnormal cell growth.
Formula:C21H34O5Purity:Min. 95%Molecular weight:366.5 g/molC14ORF101 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of C14ORF101 antibody, catalog no. 70R-8031Purity:Min. 95%GPR75 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of GPR75 antibody, catalog no. 70R-6305Purity:Min. 95%rpS6 antibody
The rpS6 antibody is a polyclonal antibody that specifically targets fibrinogen, a cation-binding protein found in human serum. It is commonly used in life sciences research to study the antigen-antibody reaction and molecular weight complexes. The rpS6 antibody has high affinity and specificity for its target and can be used in various applications such as immunoprecipitation, Western blotting, and immunofluorescence. It has been shown to have strong dna binding activity and can detect the presence of fibrinogen in platelet fibrinogen samples. Additionally, the rpS6 antibody can be used to study cation channels and their role in cellular processes. It is available as both polyclonal and monoclonal antibodies and can be used with different types of samples including nuclear extracts.Goat anti Llama IgG (H + L)
This antibody reacts with heavy chains on llama IgG and light chains on all llama immunoglobulins.Purity:Min. 95%MIP2 protein
Region of MIP2 protein corresponding to amino acids LGASWHRPDK CCLGYQKRPL PQVLLSSWYP TSQLCSKPGV IFLTKRGRQV CADKSKDWVK KLMQQLPVTA.Purity:Min. 95%PHF6 antibody
PHF6 antibody was raised in rabbit using the N terminal of PHF6 as the immunogen
Purity:Min. 95%CD19 antibody
CD19 antibody was raised in rat using Mouse CD19-expressing K562 human erythroleukemia cells as the immunogen.Calbindin 1 protein
1-261 amino acids: MAESHLQSSL ITASQFFEIW LHFDADGSGY LEGKELQNLI QELQQARKKA GLELSPEMKT FVDQYGQRDD GKIGIVELAH VLPTEENFLL LFRCQQLKSC EEFMKTWRKY DTDHSGFIET EELKNFLKDL LEKANKTVDD TKLAEYTDLM LKLFDSNNDG KLELTEMARL LPVQENFLLK FQGIKMCGKE FNKAFELYDQ DGNGYIDENE LDALLKDLCE KNKQDLDINN ITTYKKNIMA LSDGGKLYRT DLALILCAGD NPurity:>95% By Sds-PageEGFR antibody
The EGFR antibody is a highly specialized product in the field of Life Sciences. It is a histidine-rich family kinase inhibitor that specifically targets the epidermal growth factor receptor (EGFR). This antibody plays a crucial role in various biological processes, such as cell proliferation and differentiation. By binding to EGFR, it prevents the activation of downstream signaling pathways, ultimately inhibiting the growth and survival of cancer cells.Purity:Min. 95%MAGEB1 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of MAGEB1 antibody, catalog no. 70R-4381Purity:Min. 95%alpha Enolase protein
The alpha Enolase protein is a recombinant protein that falls under the category of Proteins and Antigens. It is derived from alpha-fetoprotein found in human serum and has various applications in the field of Life Sciences. This protein acts as a growth factor and has been shown to have neutralizing properties. It can be used in research studies involving antibodies, dopamine, liver microsomes, and colloidal substances. The alpha Enolase protein is highly versatile and can be utilized for a wide range of scientific experiments and investigations.Purity:Min. 95%CD69 antibody
CD69 antibody was raised in hamster using Y245 murine dendritic epidermal T cell line as the immunogen.
GPC3 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of GPC3 antibody, catalog no. 70R-1567
Purity:Min. 95%ATF2 antibody
The ATF2 antibody is a potent diagnostic agent used in Life Sciences research. This polyclonal antibody specifically targets the amino-terminal region of ATF2, a transcription factor that plays a crucial role in regulating gene expression. By binding to ATF2, this antibody inhibits its activity and can be used to study the downstream effects of ATF2 inhibition.
CMA1 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of CMA1 antibody, catalog no. 70R-9959Purity:Min. 95%PLEKHA4 antibody
PLEKHA4 antibody was raised using the middle region of PLEKHA4 corresponding to a region with amino acids TEPDSPSPVLQGEESSERESLPESLELSSPRSPETDWGRPPGGDKDLASPRG9MTD2 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of RG9MTD2 antibody, catalog no. 70R-1472Purity:Min. 95%NT5DC1 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of NT5DC1 antibody, catalog no. 70R-3114Purity:Min. 95%PCDHA12 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of PCDHA12 antibody, catalog no. 70R-6159Purity:Min. 95%FGF14 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of FGF14 antibody, catalog no. 70R-9286Purity:Min. 95%NME4 antibody
NME4 antibody was raised using the middle region of NME4 corresponding to a region with amino acids VAMVWEGYNVVRASRAMIGHTDSAEAAPGTIRGDFSVHISRNVIHASDSVNTNG1 antibody
The NTNG1 antibody is a monoclonal antibody that targets the NTNG1 protein. It plays a crucial role in various cellular processes such as fas-mediated apoptosis, collagen synthesis, and iron homeostasis. This antibody specifically binds to the NTNG1 protein, which is involved in cell growth and development. By binding to this target molecule, the NTNG1 antibody induces apoptosis in activated cells and inhibits their growth. Additionally, it has cytotoxic effects on cancer cells and has been used in research studies in the field of Life Sciences. The NTNG1 antibody can also be used for diagnostic purposes to detect autoantibodies or as a tool for studying iron metabolism and ferritin synthesis.SLC25A4 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of SLC25A4 antibody, catalog no. 70R-6504Purity:Min. 95%TOP2A antibody
The TOP2A antibody is a monoclonal antibody that specifically targets the TOP2A protein. This protein plays a crucial role in DNA replication and repair processes. The antibody binds to specific amino acid residues on the TOP2A protein, leading to its immobilization and preventing its normal function.NARF antibody
NARF antibody was raised using the middle region of NARF corresponding to a region with amino acids FRNIQNMILKLKKGKFPFHFVEVLACAGGCLNGRGQAQTPDGHADKALLRRibophorin II Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of RPN2 antibody, catalog no. 70R-6845Purity:Min. 95%Vimentin antibody
Vimentin antibody was raised in sheep using purified recombinant human vimentin produced in bacteria as the immunogen.Purity:Min. 95%Desmoyokin antibody
Desmoyokin antibody was raised in Guinea Pig using synthetic peptides of human desmoyokin coupled to KLH as the immunogen.Purity:Min. 95%MAEA antibody
The MAEA antibody is a polyclonal antibody that targets the MAEA protein. This antibody has been widely used in various life sciences research applications, including hybridization studies, immunoassays, and Western blotting. The MAEA antibody has shown neutralizing activity against insulin and leukemia inhibitory factor (LIF), making it a valuable tool for studying the role of these factors in cell signaling pathways. Additionally, this antibody has been used in studies investigating the effects of fatty acids, hepatocyte growth factor (HGF), epidermal growth factor (EGF), and insulin on cellular processes. The MAEA antibody is available conjugated to different labels, such as biotin or streptavidin, allowing for easy detection and visualization in experimental setups. With its versatility and high specificity, the MAEA antibody is an essential tool for researchers in the field of life sciences.Capping Protein beta 3 antibody
Capping Protein beta 3 antibody was raised in Guinea Pig using synthetic N-terminal domain of bovine F-actin Beta 3 subunit capping protein coupled to KLH as the immunogen.Purity:Min. 95%Meis3 antibody
Meis3 antibody was raised in rabbit using the C terminal of Meis3 as the immunogenPurity:Min. 95%Ubiquilin 1 antibody
Ubiquilin 1 antibody was raised using the middle region of UBQLN1 corresponding to a region with amino acids QFGGNPFASLVSNTSSGEGSQPSRTENRDPLPNPWAPQTSQSSSASSGTARabbit anti Sheep IgG (H + L) (FITC)
Rabbit anti-sheep IgG (H+L) (FITC) was raised in rabbit using sheep IgG whole molecule as the immunogen.Purity:Min. 95%SRPR Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of SRPR antibody, catalog no. 70R-5028Purity:Min. 95%CENPM antibody
CENPM antibody was raised using the middle region of CENPM corresponding to a region with amino acids CDLEVEGFRATMAQRLVRVLQICAGHVPGVSALNLLSLLRSSEGPSLEDLGPT Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of GPT antibody, catalog no. 70R-1194Purity:Min. 95%
![9-[4-[1-(Dimethylamino)propan-2-yl]phenyl]-8-hydroxy-5H-thieno[2,3-c]quinolin-4-one](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FNDC54081.webp&w=3840&q=75)
