Biochemicals and Reagents
Subcategories of "Biochemicals and Reagents"
- Biomolecules(98,564 products)
- By Biological Target(101,024 products)
- By Pharmacological Effects(6,952 products)
- Cryopreservatives(21 products)
- Desinfectants and Related Compounds(28 products)
- Hormones(531 products)
- Plant Biology(6,903 products)
- Secondary Metabolites(14,369 products)
Found 130609 products of "Biochemicals and Reagents"
SERPINB4 antibody
SERPINB4 antibody was raised using a synthetic peptide corresponding to a region with amino acids TSALGMVLLGAKDNTAQQISKVLHFDQVTENTTEKAATYHVDRSGNVHHQSUN2 Antibody
The SUN2 Antibody is a high-quality polyclonal antibody that is widely used in the field of Life Sciences. This antibody specifically targets SUN2, a protein involved in various cellular processes. With its strong affinity and specificity, this antibody allows for precise detection and analysis of SUN2 in different samples.Purity:Min. 95%PSMA1 antibody
PSMA1 antibody was raised using a synthetic peptide corresponding to a region with amino acids TYLERHMSEFMECNLNELVKHGLRALRETLPAEQDLTTKNVSIGIVGKDLLOC732440 antibody
LOC732440 antibody was raised in rabbit using the C terminal of LOC732440 as the immunogenPurity:Min. 95%GPX2 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of GPX2 antibody, catalog no. 70R-8525Purity:Min. 95%WDR1 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of WDR1 antibody, catalog no. 70R-3385Purity:Min. 95%SCF protein
MEGICRNRVT NNVKDVTKLV ANLPKDYMIT LKYVPGMDVL PSHCWISEMV VQLSDSLTDL LDKFSNISEG LSNYSIIDKL VNIVDDLVEC VKENSSKDLK KSFKSPEPRL FTPEEFFRIF NRSIDAFKDF VVASETSDCV VSSTLSPEKD SRVSVTKPFM LPPVAPurity:Min. 95%Mitofusin 2 antibody
Mitofusin 2 antibody was raised using the N terminal of MFN2 corresponding to a region with amino acids STVINAMLWDKVLPSGIGHTTNCFLRVEGTDGHEAFLLTEGSEEKRSAKT
Purity:Min. 95%FOXRED1 antibody
FOXRED1 antibody was raised using the N terminal of FOXRED1 corresponding to a region with amino acids SEIKKKIKSILPGRSCDLLQDTSHLPPEHSDVVIVGGGVLGLSVAYWLKK
SLC5A9 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of SLC5A9 antibody, catalog no. 70R-6790Purity:Min. 95%RPS4X antibody
The RPS4X antibody is a powerful tool in the field of Life Sciences. It is a polyclonal antibody that specifically targets the sn-38 molecule, which is known for its cytotoxic properties. This antibody has been extensively tested and proven to be highly effective in neutralizing the activity of sn-38.CSF1 antibody
CSF1 antibody was raised using a synthetic peptide corresponding to a region with amino acids SGSVLPLGELEGRRSTRDRRSPAEPEGGPASEGAARPLPRFNSVPLTDTGPurity:Min. 95%Chicken anti Rat IgG (H + L) (HRP)
This antibody reacts with heavy (gamma) chains on rat IgG and light chains on all rat immunoglobulins.Purity:Min. 95%GPT protein
The GPT protein is a versatile biomolecule with various applications in the field of medicine and biotechnology. It has been extensively studied for its role in atypical hemolytic disorders and as a potential therapeutic target for conditions such as adalimumab-resistant diseases. This protein is also known to interact with β-catenin, TNF-α, and other growth factors, making it an essential component in the development of monoclonal antibodies and protein-based therapeutics.Purity:Min. 95%Jph2 antibody
Jph2 antibody was raised in rabbit using the N terminal of Jph2 as the immunogenPurity:Min. 95%PPM1A antibody
PPM1A antibody was raised using a synthetic peptide corresponding to a region with amino acids EIDEHMRVMSEKKHGADRSGSTAVGVLISPQHTYFINCGDSRGLLCRNRKPurity:Min. 95%SMYD1 antibody
SMYD1 antibody was raised in rabbit using the N terminal of SMYD1 as the immunogenPurity:Min. 95%HDAC1 antibody
The HDAC1 antibody is a monoclonal antibody that specifically targets and binds to the histone deacetylase 1 (HDAC1) protein. This antibody is commonly used in life sciences research to study the function and regulation of HDAC1. It can be used for various applications including immunohistochemistry, western blotting, and enzyme-linked immunosorbent assays (ELISA). The HDAC1 antibody is highly specific and has been validated for use in human hepatocytes. It recognizes both the amino-terminal and carboxyl-terminal regions of HDAC1, making it a versatile tool for studying different aspects of HDAC1 biology. This antibody is biotinylated and can be easily detected using streptavidin-conjugated secondary antibodies. With its high affinity and specificity, the HDAC1 antibody is an essential tool for researchers studying epigenetics, gene expression regulation, and chromatin remodeling.
HDLBP antibody
HDLBP antibody was raised using a synthetic peptide corresponding to a region with amino acids MSSVAVLTQESFAEHRSGLVPQQIKVATLNSEEESDPPTYKDAFPPLPEK
MTCH2 antibody
MTCH2 antibody was raised using a synthetic peptide corresponding to a region with amino acids TIGRNIFGRQVCQLPGLFSYAQHIASIDGRRGLFTGLTPRLCSGVLGTVV
DSCAM antibody
DSCAM antibody was raised using the middle region of DSCAM corresponding to a region with amino acids MRVCNSAGCAEKQANFATLNYDGSTIPPLIKSVVQNEEGLTTNEGLKMLVPurity:Min. 95%LASS1 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of LASS1 antibody, catalog no. 70R-6641Purity:Min. 95%6X His tag Antibody
The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the class of rifamycins. It is highly effective in treating tuberculosis infections due to its bactericidal activity. This active compound works by binding to DNA-dependent RNA polymerase, inhibiting transcription and replication, thus preventing bacterial growth. Extensive research has been conducted on human erythrocytes using the patch-clamp technique, demonstrating its high frequency of human activity. Metabolically, it undergoes various transformations such as hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Furthermore, 6-Fluoro-3-indoxyl-beta-D-galactopyranoside specifically targets markers expressed at high levels in Mycobacterium tuberculosis strains and effectively inhibits their cellAlpha-fetoprotein antibody
Alpha-fetoprotein antibody is a monoclonal antibody that inhibits the activity of alpha-fetoprotein (AFP), a protein kinase involved in various biological processes. This antibody has been shown to neutralize the superoxide produced by AFP, thereby reducing its inhibitory effect on polymers and other enzymes. In addition, alpha-fetoprotein antibody has demonstrated anticancer activity by suppressing the growth and proliferation of cancer cells. This antibody is widely used in life sciences research and has potential applications in the development of targeted therapies for various diseases, including cancer. Furthermore, it has been found to have an inhibitory effect on collagen synthesis and may have implications for tissue repair and wound healing. With its unique properties and broad range of applications, alpha-fetoprotein antibody is an essential tool for scientists and researchers in the field of antibodies and molecular biology.
PFKFB3 antibody
The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug belonging to the class of rifamycins. It is highly effective in treating tuberculosis infections. By binding to DNA-dependent RNA polymerase, it inhibits bacterial growth by preventing transcription and replication. Its bactericidal activity has been demonstrated through patch-clamp technique on human erythrocytes. This active compound undergoes various metabolic transformations including hydrolysis, oxidation, reduction, and conjugation with glucuronic acid. Additionally, it specifically targets markers expressed in Mycobacterium tuberculosis strains, inhibiting cell growth in culture.
Cyclin E1 antibody
Cyclin E1 antibody was raised in rabbit using residues 43-52 [GSQPWDNNAVC] of cyclin E1 as the immunogen.Purity:Min. 95%UBE3A antibody
The UBE3A antibody is a powerful tool in the field of biomedical research. It belongs to the class of polyclonal antibodies and is commonly used as an inhibitor for various proteins and hormones, including VEGF (vascular endothelial growth factor) and natriuretic peptides. This antibody can be used in both in vitro and in vivo studies to investigate the role of specific proteins in different biological processes.GNGT2 antibody
GNGT2 antibody was raised using the middle region of Gngt2 corresponding to a region with amino acids KEVKNTRIPISKAGKEIKEYVEAQAGNDPFLKGIPEDKNPFKEKGGCLISC2orf60 antibody
C2orf60 antibody was raised in rabbit using the middle region of C2ORF60 as the immunogenPurity:Min. 95%160 kDa Neurofilament protein
The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the class of rifamycins. It is specifically designed to combat tuberculosis infection by targeting the active compounds responsible for bactericidal activity. This drug works by binding to DNA-dependent RNA polymerase, inhibiting transcription and replication, thereby preventing the growth of bacteria. The effectiveness of this drug has been demonstrated through extensive research using advanced techniques like transcription-quantitative polymerase chain and patch-clamp technique. Additionally, it undergoes various metabolic transformations such as hydrolysis by esterases or glucuronidases, oxidation by cytochrome p450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Furthermore, it specifically targets Mycobacterium tuberculosis strains and inhibits their cell growth in culture.Purity:Min. 95%PAK2 antibody
PAK2 antibody was raised in Mouse using a purified recombinant fragment of PAK2 expressed in E. coli as the immunogen.Adiponectin antibody
The Adiponectin antibody is a highly specialized monoclonal antibody used in Life Sciences research. It targets adiponectin, a hormone involved in various physiological processes such as metabolism and inflammation. This antibody has been extensively studied for its role in regulating epidermal growth factor (EGF) signaling, human chorionic gonadotropin (hCG) production, and anti-vascular endothelial growth factor (anti-VEGF) therapy.Rabbit anti Human IgA (biotin)
Rabbit anti-human IgA (biotin) was raised in rabbit using human IgA alpha heavy chain as the immunogen.Purity:Min. 95%Ghitm antibody
Ghitm antibody was raised in rabbit using the middle region of Ghitm as the immunogenPurity:Min. 95%RELT antibody
RELT antibody is a monoclonal antibody that specifically targets ferritin, a protein involved in iron homeostasis. This antibody has been shown to inhibit oxidative damage caused by ferritin and prevent the accumulation of iron in cells. In addition, RELT antibody has shown potential therapeutic effects against various diseases, including influenza hemagglutinin and fibrinogen-related disorders. It has also been found to inhibit the growth of hepatocyte growth factor-dependent tumors. This monoclonal antibody derivative works by binding to specific epitopes on ferritin and blocking its activity. By targeting ferritin at the molecular level, RELT antibody offers a promising approach for the development of targeted therapies in Life Sciences.
GBP2 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of GBP2 antibody, catalog no. 70R-5725Purity:Min. 95%Cyclin G1 antibody
The Cyclin G1 antibody is a powerful tool used in the field of life sciences. It is a polyclonal antibody that specifically targets and neutralizes Cyclin G1, a growth factor involved in various cellular processes. This antibody has been extensively studied and shown to have high specificity and affinity for its target.PTGES3 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of PTGES3 antibody, catalog no. 70R-2745Purity:Min. 95%NXF1 antibody
NXF1 antibody was raised using the N terminal of NXF1 corresponding to a region with amino acids MADEGKSYSEHDDERVNFPQRKKKGRGPFRWKYGEGNRRSGRGGSGIRSSSCOTIN antibody
SCOTIN antibody was raised using the middle region of Scotin corresponding to a region with amino acids CAVPEASVPASVEPVEQLGSALRFRPGYNDPMSGFGATLAVGLTIFVLSVPurity:Min. 95%Rabbit anti Guinea Pig IgG (H + L) (HRP)
This antibody reacts with heavy chains on Guinea Pig IgG and light chains on all Guinea Pig immunoglobulins.
Purity:Min. 95%PGLS antibody
PGLS antibody was raised using the middle region of PGLS corresponding to a region with amino acids AAVLKRILEDQEENPLPAALVQPHTGKLCWFLDEAAARLLTVPFEKHSTLKir4.1 antibody
The Kir4.1 antibody is a highly specific monoclonal antibody that targets the protein Kir4.1. This protein plays a crucial role in regulating potassium ion channels in the central nervous system. The antibody binds to Kir4.1 and inhibits its activity, leading to a decrease in potassium ion conductance.Annexin A2 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of ANXA2 antibody, catalog no. 70R-1679Purity:Min. 95%Donkey anti Rabbit IgG (H + L) (rhodamine)
Donkey anti-rabbit IgG (H + L) (rhodamine) was raised in donkey using rabbit IgG (H&L) as the immunogen.
Purity:Min. 95%ARAF antibody
The ARAF antibody is a protein-coupled antibody that specifically targets ARAF, a member of the RAF family of serine/threonine kinases. This antibody is commonly used in research and diagnostic assays to detect and quantify ARAF expression levels in various tissues and cell types. It has been extensively validated for its specificity and sensitivity, making it a reliable tool for studying signal transduction pathways involving ARAF. Additionally, this antibody has shown potential therapeutic applications in the field of regenerative medicine, particularly in the development of treatments for disorders related to pluripotent stem cells and fetal hemoglobin. With its high affinity and excellent performance in different experimental settings, the ARAF antibody is an essential component for life sciences research and drug discovery.Fas antibody
Fas antibody is a highly specialized inhibitor that targets Fas-mediated apoptosis. It works by blocking the interaction between Fas and its ligand, preventing cell death signaling. This antibody has been extensively studied in various research fields, including epidermal growth factor signaling, histidine metabolism, and α-synuclein aggregation.Purity:Min. 95%Progesterone Receptor Antibody
The Progesterone Receptor Antibody is a monoclonal antibody used in Life Sciences research. It specifically targets the progesterone receptor, a protein involved in various biological processes such as cell growth and differentiation. This antibody can be used to study the role of progesterone and its receptor in different tissues and cell types.C19ORF62 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of C19orf62 antibody, catalog no. 70R-4229Purity:Min. 95%FGFR4 antibody
FGFR4 antibody was raised in Mouse using purified recombinant extracellular fragment of human FGFR4 fused with hIgGFc tag expressed in HEK293 cell line as the immunogen.Goat anti Human IgG (HRP)
This antibody reacts with heavy chains on human IgG (gamma chain).Purity:Min. 95%SmG antibody
The SmG antibody is a highly specialized monoclonal antibody used in Life Sciences research. It is specifically designed to target and bind to the Sm protein, which plays a crucial role in RNA processing and splicing. This antibody has been extensively tested and validated for use in various assays, including Western blotting, immunohistochemistry, and immunofluorescence. The SmG antibody can be used to study the expression and localization of the Sm protein in different cell types and tissues. It has also been shown to have cyclase-activating properties, leading to increased intracellular levels of cyclic AMP (cAMP). This antibody is an essential tool for researchers studying RNA processing, gene expression regulation, and cellular signaling pathways.WDHD1 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of WDHD1 antibody, catalog no. 70R-8288Purity:Min. 95%CLIC5 antibody
CLIC5 antibody was raised using the C terminal of CLIC5 corresponding to a region with amino acids YRNYDIPAEMTGLWRYLKNAYARDEFTNTCAADSEIELAYADVAKRLSRSE. coli O157 antibody
E. coli O157 antibody was raised in mouse using 'O' antigen of E. coli serotype O157 as the immunogen.TFRC antibody
The TFRC antibody is a powerful tool used in Life Sciences research. It is a polyclonal antibody that specifically targets the transferrin receptor (TFRC), a protein involved in the transport of iron into cells. This antibody can be used to study various aspects of cell biology and molecular processes.
