CymitQuimica logo
Biochemicals and Reagents

Biochemicals and Reagents

Biochemicals and reagents are fundamental substances for research and development in fields such as biotechnology, molecular biology, pharmacology, and medicine. These products are essential for a variety of applications, including compound synthesis, biological sample analysis, metabolic process research, and drug production. At CymitQuimica, we offer a wide selection of high-quality, high-purity biochemicals and reagents suitable for various scientific and industrial needs. Our catalog includes enzymes, antibodies, nucleic acids, amino acids, and many other products, all designed to support researchers and professionals in their research and development projects, ensuring reliable and reproducible results.

Subcategories of "Biochemicals and Reagents"

Found 130609 products of "Biochemicals and Reagents"

Sort by

Purity (%)
0
100
|
0
|
50
|
90
|
95
|
100
products per page.
  • Carboxypeptidase N2 Blocking Peptide


    A synthetic peptide for use as a blocking control in assays to test for specificity of CPN2 antibody, catalog no. 70R-3276

    Purity:Min. 95%

    Ref: 3D-33R-3103

    100µg
    Discontinued
    Discontinued product
  • CD209 antibody


    The CD209 antibody is a highly specialized monoclonal antibody used in the field of Life Sciences. It is designed to target and neutralize specific fatty acids present in biological samples. This antibody is produced using advanced chromatographic techniques, ensuring high purity and specificity. The CD209 antibody can be used for various applications, including research, diagnostics, and therapeutics. Its unique ability to bind to specific molecules makes it an invaluable tool for studying cellular processes and developing new medicaments. Whether you're a scientist or a pharmaceutical company, the CD209 antibody is an essential component of your research toolkit.

    Purity:Min. 95%

    Ref: 3D-20R-2703

    50µg
    Discontinued
    Discontinued product
  • CD54 antibody


    6-Fluoro-3-indoxyl-beta-D-galactopyranoside is an active compound used as an antituberculosis drug. It belongs to the class of rifamycins and is highly effective in treating tuberculosis infections. This powerful drug works by inhibiting bacterial growth through its bactericidal activity. By binding to DNA-dependent RNA polymerase, it prevents transcription and replication, effectively stopping the spread of the infection. Additionally, 6-Fluoro-3-indoxyl-beta-D-galactopyranoside has been extensively studied using advanced techniques such as transcription-quantitative polymerase chain and patch-clamp technique. Its metabolic transformations include hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. It specifically targets Mycobacterium tuberculosis strains and inhibits their cell growth in culture.

    Ref: 3D-70R-13774

    100µg
    Discontinued
    Discontinued product
  • COX15 antibody


    COX15 antibody was raised using a synthetic peptide corresponding to a region with amino acids DWHLIKEMKPPTSQEEWEAEFQRYQQFPEFKILNHDMTLTEFKFIWYMEY

    Ref: 3D-70R-1746

    100µl
    Discontinued
    Discontinued product
  • SMARCAL1 antibody


    Rabbit polyclonal SMARCAL1 antibody

    Ref: 3D-70R-20391

    50µl
    Discontinued
    Discontinued product
  • ACOT11 Blocking Peptide


    A synthetic peptide for use as a blocking control in assays to test for specificity of ACOT11 antibody, catalog no. 70R-5871

    Purity:Min. 95%

    Ref: 3D-33R-10276

    100µg
    Discontinued
    Discontinued product
  • F7 Blocking Peptide


    A synthetic peptide for use as a blocking control in assays to test for specificity of F7 antibody, catalog no. 70R-9970

    Purity:Min. 95%

    Ref: 3D-33R-7835

    100µg
    Discontinued
    Discontinued product
  • CSF2RA antibody


    CSF2RA antibody was raised in Rabbit using Human CSF2RA as the immunogen

    Ref: 3D-70R-16615

    50µl
    Discontinued
    Discontinued product
  • POLR2K Blocking Peptide


    A synthetic peptide for use as a blocking control in assays to test for specificity of POLR2K antibody, catalog no. 70R-2961

    Purity:Min. 95%

    Ref: 3D-33R-2205

    100µg
    Discontinued
    Discontinued product
  • STAT2 antibody


    The STAT2 antibody is a highly specialized antibody that plays a crucial role in the interferon signaling pathway. It specifically targets and binds to STAT2, a protein involved in regulating gene expression in response to interferon signals. By binding to STAT2, this antibody effectively inhibits its activity, preventing the downstream effects of interferon signaling.

    Ref: 3D-70R-14048

    100µg
    Discontinued
    Discontinued product
  • Resistin antibody


    Resistin antibody was raised in goat using highly pure recombinant murine resistin as the immunogen.
    Purity:Min. 95%

    Ref: 3D-70R-RG001

    100µg
    Discontinued
    Discontinued product
  • GPR18 antibody


    The GPR18 antibody is a polyclonal antibody used in the field of Life Sciences. It is commonly used in various assays and experiments to study the functions and interactions of GPR18, a glycoprotein receptor. This antibody is highly specific and has been proven effective in detecting GPR18 in different biological samples.

    Ref: 3D-70R-31413

    100µg
    Discontinued
    Discontinued product
  • CD8b antibody (FITC)


    Mouse monoclonal CD8b antibody (FITC)

    Ref: 3D-61R-1045

    50µg
    Discontinued
    Discontinued product
  • SNF1LK Blocking Peptide


    A synthetic peptide for use as a blocking control in assays to test for specificity of SNF1LK antibody, catalog no. 70R-1185

    Purity:Min. 95%

    Ref: 3D-33R-6587

    100µg
    Discontinued
    Discontinued product
  • Complement C8 antibody


    Complement C8 antibody was raised in goat using highly purified human complement protein as the immunogen.
    Purity:Min. 95%

    Ref: 3D-20C-CR2038G

    1ml
    Discontinued
    Discontinued product
  • CLN2 antibody


    Affinity purified Rabbit polyclonal CLN2 antibody

    Ref: 3D-70R-12756

    100µl
    Discontinued
    Discontinued product
  • FH antibody


    FH antibody is a monoclonal antibody used in Life Sciences research. It specifically targets and binds to the growth factor FH, preventing its dephosphorylation and promoting the formation of dimers. This antibody has been shown to inhibit interferon-induced cell death and activate mitogen-activated protein (MAP) kinase signaling pathways. Additionally, FH antibody has been found to modulate arachidonic acid metabolism and enhance the effects of epidermal growth factor (EGF). It can also be used in the detection of atypical hemolytic uremic syndrome (aHUS) and as a tool for studying autoantibodies. FH antibody is part of a range of high-quality monoclonal antibodies designed for various applications in Life Sciences research.

    Ref: 3D-10R-4121

    100µl
    Discontinued
    Discontinued product
  • OSBPL8 Blocking Peptide


    A synthetic peptide for use as a blocking control in assays to test for specificity of OSBPL8 antibody, catalog no. 70R-6726

    Purity:Min. 95%

    Ref: 3D-33R-10252

    100µg
    Discontinued
    Discontinued product
  • STK38L Blocking Peptide


    A synthetic peptide for use as a blocking control in assays to test for specificity of STK38L antibody, catalog no. 70R-4530

    Purity:Min. 95%

    Ref: 3D-33R-6952

    100µg
    Discontinued
    Discontinued product
  • Osteocalcin protein


    Osteocalcin protein is a versatile protein with various characteristics and applications. It has been found to play a role in epidermal growth and is involved in the regulation of alpha-synuclein, c-myc, and human chorionic gonadotropin. Osteocalcin protein can be used as a monoclonal antibody for research purposes, particularly in the field of Life Sciences. This protein contains tyrosine residues that are crucial for its function. Osteocalcin protein is also utilized in the development of native proteins and antigens, making it an essential component in many scientific studies. Additionally, it has shown potential as an anti-VEGF agent and has been associated with neurotrophic effects and the induction of fas-mediated apoptosis. Its multifaceted properties make osteocalcin protein an invaluable tool in various research fields.
    Purity:>95% By Sds-Page

    Ref: 3D-30C-CP3015U

    1u
    Discontinued
    20µg
    Discontinued
    Discontinued product