Biochemicals and Reagents
Subcategories of "Biochemicals and Reagents"
- Biomolecules(98,563 products)
- By Biological Target(101,024 products)
- By Pharmacological Effects(6,952 products)
- Cryopreservatives(21 products)
- Desinfectants and Related Compounds(28 products)
- Hormones(531 products)
- Plant Biology(6,903 products)
- Secondary Metabolites(14,369 products)
Found 130609 products of "Biochemicals and Reagents"
Carboxypeptidase N2 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of CPN2 antibody, catalog no. 70R-3276
Purity:Min. 95%CD209 antibody
The CD209 antibody is a highly specialized monoclonal antibody used in the field of Life Sciences. It is designed to target and neutralize specific fatty acids present in biological samples. This antibody is produced using advanced chromatographic techniques, ensuring high purity and specificity. The CD209 antibody can be used for various applications, including research, diagnostics, and therapeutics. Its unique ability to bind to specific molecules makes it an invaluable tool for studying cellular processes and developing new medicaments. Whether you're a scientist or a pharmaceutical company, the CD209 antibody is an essential component of your research toolkit.
Purity:Min. 95%CD54 antibody
6-Fluoro-3-indoxyl-beta-D-galactopyranoside is an active compound used as an antituberculosis drug. It belongs to the class of rifamycins and is highly effective in treating tuberculosis infections. This powerful drug works by inhibiting bacterial growth through its bactericidal activity. By binding to DNA-dependent RNA polymerase, it prevents transcription and replication, effectively stopping the spread of the infection. Additionally, 6-Fluoro-3-indoxyl-beta-D-galactopyranoside has been extensively studied using advanced techniques such as transcription-quantitative polymerase chain and patch-clamp technique. Its metabolic transformations include hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. It specifically targets Mycobacterium tuberculosis strains and inhibits their cell growth in culture.
COX15 antibody
COX15 antibody was raised using a synthetic peptide corresponding to a region with amino acids DWHLIKEMKPPTSQEEWEAEFQRYQQFPEFKILNHDMTLTEFKFIWYMEY
ACOT11 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of ACOT11 antibody, catalog no. 70R-5871
Purity:Min. 95%F7 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of F7 antibody, catalog no. 70R-9970
Purity:Min. 95%POLR2K Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of POLR2K antibody, catalog no. 70R-2961
Purity:Min. 95%STAT2 antibody
The STAT2 antibody is a highly specialized antibody that plays a crucial role in the interferon signaling pathway. It specifically targets and binds to STAT2, a protein involved in regulating gene expression in response to interferon signals. By binding to STAT2, this antibody effectively inhibits its activity, preventing the downstream effects of interferon signaling.
Resistin antibody
Resistin antibody was raised in goat using highly pure recombinant murine resistin as the immunogen.Purity:Min. 95%GPR18 antibody
The GPR18 antibody is a polyclonal antibody used in the field of Life Sciences. It is commonly used in various assays and experiments to study the functions and interactions of GPR18, a glycoprotein receptor. This antibody is highly specific and has been proven effective in detecting GPR18 in different biological samples.
SNF1LK Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of SNF1LK antibody, catalog no. 70R-1185
Purity:Min. 95%Complement C8 antibody
Complement C8 antibody was raised in goat using highly purified human complement protein as the immunogen.Purity:Min. 95%FH antibody
FH antibody is a monoclonal antibody used in Life Sciences research. It specifically targets and binds to the growth factor FH, preventing its dephosphorylation and promoting the formation of dimers. This antibody has been shown to inhibit interferon-induced cell death and activate mitogen-activated protein (MAP) kinase signaling pathways. Additionally, FH antibody has been found to modulate arachidonic acid metabolism and enhance the effects of epidermal growth factor (EGF). It can also be used in the detection of atypical hemolytic uremic syndrome (aHUS) and as a tool for studying autoantibodies. FH antibody is part of a range of high-quality monoclonal antibodies designed for various applications in Life Sciences research.
OSBPL8 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of OSBPL8 antibody, catalog no. 70R-6726
Purity:Min. 95%STK38L Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of STK38L antibody, catalog no. 70R-4530
Purity:Min. 95%Osteocalcin protein
Osteocalcin protein is a versatile protein with various characteristics and applications. It has been found to play a role in epidermal growth and is involved in the regulation of alpha-synuclein, c-myc, and human chorionic gonadotropin. Osteocalcin protein can be used as a monoclonal antibody for research purposes, particularly in the field of Life Sciences. This protein contains tyrosine residues that are crucial for its function. Osteocalcin protein is also utilized in the development of native proteins and antigens, making it an essential component in many scientific studies. Additionally, it has shown potential as an anti-VEGF agent and has been associated with neurotrophic effects and the induction of fas-mediated apoptosis. Its multifaceted properties make osteocalcin protein an invaluable tool in various research fields.Purity:>95% By Sds-Page
