Biochemicals and Reagents
Subcategories of "Biochemicals and Reagents"
- Biomolecules(98,557 products)
- By Biological Target(101,014 products)
- By Pharmacological Effects(6,941 products)
- Cryopreservatives(21 products)
- Desinfectants and Related Compounds(28 products)
- Hormones(530 products)
- Plant Biology(6,903 products)
- Secondary Metabolites(14,371 products)
Found 130589 products of "Biochemicals and Reagents"
Chicken RBC antibody
Chicken RBC antibody was raised in rabbit using chicken erythrocytes as the immunogen.Purity:Min. 95%CD105 antibody
CD105 antibody was raised in rabbit using recombinant human soluble CD105/Endoglin as the immunogen.
Purity:Min. 95%CD27 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of CD27 antibody, catalog no. 70R-9668Purity:Min. 95%FBXW9 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of FBXW9 antibody, catalog no. 70R-10074
Purity:Min. 95%SOX4 antibody
SOX4 antibody was raised in rabbit using the N terminal of SOX4 as the immunogen
Purity:Min. 95%MARS Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of MARS antibody, catalog no. 70R-7943
Purity:Min. 95%Cytokeratin 10 antibody
Cytokeratin 10 antibody is a collagen-based product that is used in Life Sciences research. This antibody has antiviral properties and can be used in experiments involving electrodes. It is a monoclonal antibody that has neutralizing effects on certain growth factors. Cytokeratin 10 antibody can be used in the detection of specific proteins in human serum, such as fibrinogen, anti-mesothelin, and alpha-fetoprotein. It can also be used as an activated inhibitor in various assays and experiments. With its high specificity and effectiveness, this antibody is a valuable tool for researchers in the field of Life Sciences.
C9ORF4 antibody
C9ORF4 antibody was raised using the N terminal Of C9Orf4 corresponding to a region with amino acids PAACAASPADDGAGPGGRGPRGRARGDTGADEAVPRHDSSYGTFAGEFYDPurity:Min. 95%APCS antibody
APCS antibody was raised using the N terminal of APCS corresponding to a region with amino acids NFTLCFRAYSDLSRAYSLFSYNTQGRDNELLVYKERVGEYSLYIGRHKVT
SLC39A4 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of SLC39A4 antibody, catalog no. 70R-6695
Purity:Min. 95%CYP2J2 antibody
The CYP2J2 antibody is a highly specialized monoclonal antibody used in Life Sciences research. It is specifically designed to target and detect the CYP2J2 enzyme, which plays a crucial role in the metabolism of drugs and other foreign substances in the body. This antibody is commonly used in studies involving mesenchymal stem cells, reactive oxygen species, and electrode-based assays.
Troponin T antibody (Cardiac)
Troponin T antibody (cardiac) was raised in mouse using free human cTnT as the immunogen.
GSTT1 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of GSTT1 antibody, catalog no. 70R-2157
Purity:Min. 95%TRAF3IP3 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of TRAF3IP3 antibody, catalog no. 70R-6912
Purity:Min. 95%DNAJC10 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of DNAJC10 antibody, catalog no. 70R-6576
Purity:Min. 95%
