Biochemicals and Reagents
Subcategories of "Biochemicals and Reagents"
- Biomolecules(98,557 products)
- By Biological Target(100,866 products)
- By Pharmacological Effects(6,941 products)
- Cryopreservatives(21 products)
- Desinfectants and Related Compounds(28 products)
- Hormones(530 products)
- Plant Biology(6,903 products)
- Secondary Metabolites(14,368 products)
Found 130563 products of "Biochemicals and Reagents"
EIF3G Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of EIF3G antibody, catalog no. 70R-4993
Purity:Min. 95%NDUFC2 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of NDUFC2 antibody, catalog no. 70R-6518
Purity:Min. 95%STAC3 antibody
The STAC3 antibody is a recombinant antigen that has shown potential in the treatment of non-alcoholic steatohepatitis (NASH). This effective substance belongs to the class of antibodies, which are proteins that can specifically bind to certain molecules in the body. The STAC3 antibody has been tested as a test substance for its ability to inhibit protein kinase activity, an enzyme involved in various cellular processes. Inhibitors of protein kinases have been studied extensively in Life Sciences for their potential therapeutic applications.
MMP23B Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of MMP23B antibody, catalog no. 70R-6959
Purity:Min. 95%MEF2A antibody
The MEF2A antibody is a powerful tool used in life sciences research. It is a monoclonal antibody that specifically targets the MEF2A protein, which plays a crucial role in various cellular processes including growth factor signaling and interferon production. This antibody can be used for a wide range of applications, such as western blotting, immunofluorescence, and immunohistochemistry.
Purity:Min. 95%Rad9 antibody
Rad9 antibody is a monoclonal antibody that specifically binds to Rad9, a protein involved in DNA damage response and repair. This antibody has been shown to be highly effective in detecting Rad9 in various biological samples, including pleural fluid and human serum. It can be used for research purposes in the field of life sciences to study the role of Rad9 in cellular processes such as DNA repair, cell cycle regulation, and apoptosis. Additionally, Rad9 antibody has antiangiogenic properties and can inhibit endothelial growth by binding to specific receptors on endothelial cells. Its cytotoxic effects make it a promising candidate for targeted cancer therapy. With its high specificity and affinity for Rad9, this antibody is an invaluable tool for scientists studying biomolecules and their interactions.
CXCL1 protein
CXCL1 protein is a chemokine that plays a crucial role in immune response and inflammation. It is a small cytokine that acts as a chemoattractant for neutrophils and other inflammatory cells. CXCL1 protein has been extensively studied in Life Sciences and has shown potential therapeutic applications.
Purity:Min. 95%ZNF71 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of ZNF71 antibody, catalog no. 70R-8360
Purity:Min. 95%FAM62B Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of FAM62B antibody, catalog no. 70R-6901
Purity:Min. 95%USP15 antibody
The USP15 antibody is a trifunctional antibody that has multiple applications in the field of Life Sciences. This antibody specifically targets and binds to USP15, which is an enzyme involved in the regulation of various cellular processes. The USP15 antibody can be used for research purposes, such as studying the role of USP15 in different signaling pathways or investigating its interaction with other proteins.
GLUD1 antibody
GLUD1 antibody was raised using the N terminal of GLUD1 corresponding to a region with amino acids EGFFDRGASIVEDKLVEDLRTRESEEQKRNRVRGILRIIKPCNHVLSLSF
Keratin 19 antibody
The Keratin 19 antibody is a highly specialized monoclonal antibody that targets the growth factor Keratin 19. It is commonly used in Life Sciences research for various applications such as hybridization studies, high-affinity glucose binding assays, and polymerase chain reactions (PCR). This antibody can also be utilized in the development of polymeric micelles for drug delivery systems and as a tool in gene therapy using adeno-associated virus vectors. Additionally, the Keratin 19 antibody has been shown to play a role in preventing deprivation-induced apoptosis by targeting molecular pathways involved in cell survival. Its specificity towards Keratin 19 makes it an ideal tool for studying sugar transport mechanisms, collagen synthesis, and the effects of compounds like okadaic acid on cellular processes. With its exceptional affinity and versatility, the Keratin 19 antibody is an invaluable asset for researchers exploring a wide range of molecular targets in their scientific investigations.
PYCR1 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of PYCR1 antibody, catalog no. 70R-5329
Purity:Min. 95%
