CymitQuimica logo
Biochemicals and Reagents

Biochemicals and Reagents

Biochemicals and reagents are fundamental substances for research and development in fields such as biotechnology, molecular biology, pharmacology, and medicine. These products are essential for a variety of applications, including compound synthesis, biological sample analysis, metabolic process research, and drug production. At CymitQuimica, we offer a wide selection of high-quality, high-purity biochemicals and reagents suitable for various scientific and industrial needs. Our catalog includes enzymes, antibodies, nucleic acids, amino acids, and many other products, all designed to support researchers and professionals in their research and development projects, ensuring reliable and reproducible results.

Subcategories of "Biochemicals and Reagents"

Found 130563 products of "Biochemicals and Reagents"

Sort by

Purity (%)
0
100
|
0
|
50
|
90
|
95
|
100
products per page.
  • EIF3G Blocking Peptide


    A synthetic peptide for use as a blocking control in assays to test for specificity of EIF3G antibody, catalog no. 70R-4993

    Purity:Min. 95%

    Ref: 3D-33R-5350

    100µg
    Discontinued
    Discontinued product
  • NDUFC2 Blocking Peptide


    A synthetic peptide for use as a blocking control in assays to test for specificity of NDUFC2 antibody, catalog no. 70R-6518

    Purity:Min. 95%

    Ref: 3D-33R-3898

    100µg
    Discontinued
    Discontinued product
  • TR19L antibody


    Rabbit polyclonal TR19L antibody

    Ref: 3D-70R-32062

    1u
    Discontinued
    100µg
    Discontinued
    Discontinued product
  • STAC3 antibody


    The STAC3 antibody is a recombinant antigen that has shown potential in the treatment of non-alcoholic steatohepatitis (NASH). This effective substance belongs to the class of antibodies, which are proteins that can specifically bind to certain molecules in the body. The STAC3 antibody has been tested as a test substance for its ability to inhibit protein kinase activity, an enzyme involved in various cellular processes. Inhibitors of protein kinases have been studied extensively in Life Sciences for their potential therapeutic applications.

    Ref: 3D-70R-20559

    50µl
    Discontinued
    Discontinued product
  • MMP23B Blocking Peptide


    A synthetic peptide for use as a blocking control in assays to test for specificity of MMP23B antibody, catalog no. 70R-6959

    Purity:Min. 95%

    Ref: 3D-33R-7605

    100µg
    Discontinued
    Discontinued product
  • MEF2A antibody


    The MEF2A antibody is a powerful tool used in life sciences research. It is a monoclonal antibody that specifically targets the MEF2A protein, which plays a crucial role in various cellular processes including growth factor signaling and interferon production. This antibody can be used for a wide range of applications, such as western blotting, immunofluorescence, and immunohistochemistry.

    Purity:Min. 95%

    Ref: 3D-20R-2130

    50µg
    Discontinued
    Discontinued product
  • RPA2 antibody (FITC)


    Rabbit polyclonal RPA2 antibody (FITC)

    Ref: 3D-60R-1276

    100µg
    Discontinued
    Discontinued product
  • Rad9 antibody


    Rad9 antibody is a monoclonal antibody that specifically binds to Rad9, a protein involved in DNA damage response and repair. This antibody has been shown to be highly effective in detecting Rad9 in various biological samples, including pleural fluid and human serum. It can be used for research purposes in the field of life sciences to study the role of Rad9 in cellular processes such as DNA repair, cell cycle regulation, and apoptosis. Additionally, Rad9 antibody has antiangiogenic properties and can inhibit endothelial growth by binding to specific receptors on endothelial cells. Its cytotoxic effects make it a promising candidate for targeted cancer therapy. With its high specificity and affinity for Rad9, this antibody is an invaluable tool for scientists studying biomolecules and their interactions.

    Ref: 3D-70R-12485

    100µl
    Discontinued
    Discontinued product
  • CXCL1 protein


    CXCL1 protein is a chemokine that plays a crucial role in immune response and inflammation. It is a small cytokine that acts as a chemoattractant for neutrophils and other inflammatory cells. CXCL1 protein has been extensively studied in Life Sciences and has shown potential therapeutic applications.

    Purity:Min. 95%

    Ref: 3D-30R-3156

    100µg
    Discontinued
    Discontinued product
  • ZNF71 Blocking Peptide


    A synthetic peptide for use as a blocking control in assays to test for specificity of ZNF71 antibody, catalog no. 70R-8360

    Purity:Min. 95%

    Ref: 3D-33R-6133

    100µg
    Discontinued
    Discontinued product
  • 25OH Vitamin D2/D3 antibody


    Mouse anti-25OH Vitamin D2/D3 antibody

    Ref: 3D-10-2785

    1mg
    Discontinued
    Discontinued product
  • FAM62B Blocking Peptide


    A synthetic peptide for use as a blocking control in assays to test for specificity of FAM62B antibody, catalog no. 70R-6901

    Purity:Min. 95%

    Ref: 3D-33R-6875

    100µg
    Discontinued
    Discontinued product
  • USP15 antibody


    The USP15 antibody is a trifunctional antibody that has multiple applications in the field of Life Sciences. This antibody specifically targets and binds to USP15, which is an enzyme involved in the regulation of various cellular processes. The USP15 antibody can be used for research purposes, such as studying the role of USP15 in different signaling pathways or investigating its interaction with other proteins.

    Ref: 3D-70R-12824

    100µl
    Discontinued
    Discontinued product
  • EDN1 antibody


    EDN1 antibody was raised in Rabbit using Human EDN1 as the immunogen

    Ref: 3D-70R-16996

    50µl
    Discontinued
    Discontinued product
  • GLUD1 antibody


    GLUD1 antibody was raised using the N terminal of GLUD1 corresponding to a region with amino acids EGFFDRGASIVEDKLVEDLRTRESEEQKRNRVRGILRIIKPCNHVLSLSF

    Ref: 3D-70R-2596

    100µl
    Discontinued
    Discontinued product
  • CRABP1 antibody


    CRABP1 antibody was raised in Rabbit using Human CRABP1 as the immunogen

    Ref: 3D-70R-16574

    50µl
    Discontinued
    Discontinued product
  • Keratin 19 antibody


    The Keratin 19 antibody is a highly specialized monoclonal antibody that targets the growth factor Keratin 19. It is commonly used in Life Sciences research for various applications such as hybridization studies, high-affinity glucose binding assays, and polymerase chain reactions (PCR). This antibody can also be utilized in the development of polymeric micelles for drug delivery systems and as a tool in gene therapy using adeno-associated virus vectors. Additionally, the Keratin 19 antibody has been shown to play a role in preventing deprivation-induced apoptosis by targeting molecular pathways involved in cell survival. Its specificity towards Keratin 19 makes it an ideal tool for studying sugar transport mechanisms, collagen synthesis, and the effects of compounds like okadaic acid on cellular processes. With its exceptional affinity and versatility, the Keratin 19 antibody is an invaluable asset for researchers exploring a wide range of molecular targets in their scientific investigations.

    Ref: 3D-70R-31254

    100µg
    Discontinued
    Discontinued product
  • alpha SNAP antibody


    Affinity purified Rabbit polyclonal alpha SNAP antibody

    Ref: 3D-70R-13022

    100µl
    Discontinued
    Discontinued product
  • PYCR1 Blocking Peptide


    A synthetic peptide for use as a blocking control in assays to test for specificity of PYCR1 antibody, catalog no. 70R-5329

    Purity:Min. 95%

    Ref: 3D-33R-4559

    100µg
    Discontinued
    Discontinued product
  • STA13 antibody


    Rabbit polyclonal STA13 antibody

    Ref: 3D-70R-32231

    100µg
    Discontinued
    Discontinued product