Biochemicals and Reagents
Subcategories of "Biochemicals and Reagents"
- Biomolecules(98,575 products)
- By Biological Target(100,710 products)
- By Pharmacological Effects(6,937 products)
- Cryopreservatives(21 products)
- Desinfectants and Related Compounds(28 products)
- Hormones(421 products)
- Plant Biology(6,907 products)
- Secondary Metabolites(14,367 products)
Found 130493 products of "Biochemicals and Reagents"
VDAC1 antibody
VDAC1 antibody was raised using the C terminal of VDAC1 corresponding to a region with amino acids SAKVNNSSLIGLGYTQTLKPGIKLTLSALLDGKNVNAGGHKLGLGLEFQA
Haptoglobin Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of HP antibody, catalog no. 70R-5459
Purity:Min. 95%KLK6 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of KLK6 antibody, catalog no. 70R-2466
Purity:Min. 95%SNAG1 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of SNAG1 antibody, catalog no. 70R-9638
Purity:Min. 95%FBXO18 antibody
FBXO18 antibody was raised in mouse using recombinant Human F-Box Protein, Helicase, 18 (Fbxo18)PGM3 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of PGM3 antibody, catalog no. 70R-3268
Purity:Min. 95%Ruxolitinib sulfate
CAS:Ruxolitinib is a small molecule that inhibits the activity of PD-1, which is a protein that regulates immune responses. Ruxolitinib has been shown to be effective against myelofibrosis and other diseases that are characterized by cellular dedifferentiation, such as chronic graft versus host disease. It also inhibits the production of proteins involved in tumor growth and progression. Ruxolitinib binds to PD-L1, an inhibitory receptor on T cells, and blocks the interaction between PD-L1 and its ligands, preventing T cell activation. The binding of ruxolitinib with PD-L1 can induce receptor internalization or activate downstream signalling pathways for apoptosis.
Formula:C17H20N6O4SPurity:Min. 95%Molecular weight:404.4 g/molRef: 3D-STB93916
Discontinued productALDH3A1 antibody
The ALDH3A1 antibody is a powerful tool in the field of antiviral research. It belongs to the class of Monoclonal Antibodies, which are highly specific and effective in targeting specific antigens. This antibody has been extensively studied for its ability to neutralize autoantibodies and antibodies that can cause autoimmune diseases. It has also shown promising results in combination with gemcitabine treatment, enhancing the effectiveness of this chemotherapy drug.C11ORF65 antibody
C11ORF65 antibody was raised using the N terminal Of C11Orf65 corresponding to a region with amino acids MPWKEESEFTKQDKAARVIQQAWKSFLNVAIFQHFKSLIDLRRQGEPRQI
Lipase J Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of LIPJ antibody, catalog no. 70R-4117
Purity:Min. 95%PUS10 antibody
PUS10 antibody was raised using the middle region of PUS10 corresponding to a region with amino acids AVFVAGRYNKYSRNLPQTPWIIDGERKLESSVEELISDHLLAVFKAESFN
Fgf1 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of Fgf1 antibody, catalog no. 70R-8011
Purity:Min. 95%GNB1L Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of GNB1L antibody, catalog no. 70R-1642
Purity:Min. 95%Atractylodinol
CAS:Atractylodinol is a chemical compound that is found in the Phellodendron amurense and Japonica species. It has potent inhibitory activity against viruses and infectious diseases, such as hepatitis B virus, herpes simplex virus type 1 (HSV-1), herpes simplex virus type 2 (HSV-2), human immunodeficiency virus type 1 (HIV-1), influenza A virus, and West Nile virus. Atractylodinol binds to the receptor binding site of the viral envelope protein, which inhibits viral entry into cells. This compound has shown to be effective against HSV-1, HSV-2, HIV-1, and West Nile Virus in vitro. Atractylodinol also shows inhibitory activity against bacterial cells by inhibiting protein synthesis at the ribosomes.
Formula:C13H10O2Purity:Min. 95%Molecular weight:198.22 g/molAnnexin A5 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of ANXA5 antibody, catalog no. 70R-1668Purity:Min. 95%Rabbit anti Cat IgG (H + L) (biotin)
Rabbit anti-cat IgG (H+L) (biotin) was raised in rabbit using feline IgG whole molecule as the immunogen.
Purity:Min. 95%
