Biochemicals and Reagents

The PAR4 antibody is a potent antiviral agent that belongs to the class of antibodies. It is available in both polyclonal and monoclonal forms, with the monoclonal antibody being highly neutralizing. This antibody specifically targets the PAR4 receptor, which is involved in various cellular processes such as cyclase-activating and ketamine signaling. In the field of Life Sciences, this antibody is widely used for research purposes due to its high specificity and affinity for PAR4. It can be utilized for studying biomolecules like transferrin, low density lipoprotein (LDL), globulin, and erythropoietin. The PAR4 antibody is also commonly used in immunoassays and other analytical techniques to detect and quantify PAR4 levels. Its colloidal properties make it suitable for various applications in the biomedical field.

Purified recombinant CCDC43 protein (His tag)

MLF1 antibody was raised in Rabbit using Human MLF1 as the immunogen

The Ephrin A1 antibody is a highly specialized antibody used in the field of Life Sciences. It is particularly effective against HER2, a protein that plays a crucial role in various cellular processes. This antibody has been extensively tested and has shown high affinity towards HER2, making it an ideal tool for research and diagnostic purposes.

The ILK antibody is a powerful tool used in scientific research and diagnostics. This monoclonal antibody specifically targets ILK (Integrin-Linked Kinase), a key protein involved in various cellular processes. It plays a crucial role in cell adhesion, migration, proliferation, and survival.

A synthetic peptide for use as a blocking control in assays to test for specificity of CYP2C19 antibody, catalog no. 70R-5326

Epsilon Tubulin 1 antibody was raised using the middle region of TUBE1 corresponding to a region with amino acids PSGEDDVITSPYNSILAMKELNEHADCVLPIDNQSLFDIISKIDLMVNSG

DBP antibody was raised in mouse using recombinant Albumin D-Box Binding Protein

The alpha Actin antibody is a powerful tool used in Life Sciences research. It belongs to the category of antibodies, specifically polyclonal and monoclonal antibodies. This antibody is known for its neutralizing properties against fibronectin, chemokines, growth factors, and collagen. It has been extensively studied and proven to be highly specific in detecting and targeting alpha Actin, an important protein involved in cell structure and movement. The alpha Actin antibody can be used in various applications such as immunohistochemistry, western blotting, and flow cytometry to study the expression and localization of alpha Actin in different tissues and cell types. Researchers rely on this specific antibody to gain insights into cellular processes, signaling pathways, and disease mechanisms related to actin dynamics.

A synthetic peptide for use as a blocking control in assays to test for specificity of SLC25A25 antibody, catalog no. 70R-6787

A synthetic peptide for use as a blocking control in assays to test for specificity of HSPA1A antibody, catalog no. 70R-1244

Affinity purified Rabbit polyclonal IGSF3 antibody

Affinity purified Rabbit polyclonal KLRC4 antibody

The ZHX2 antibody is a highly specialized product in the field of Life Sciences. It is specifically designed to neutralize lipoprotein lipase, an enzyme involved in lipid metabolism. This antibody can be used as a research tool to study the function and regulation of lipoprotein lipase in various biological systems.

RAD9A antibody was raised in rabbit using the C terminal of RAD9A as the immunogen

L-alpha-methyldopa hydrochloride is a peptide that is used as a research tool. It is an activator, which means it promotes the activity of other substances. L-alpha-methyldopa hydrochloride is a ligand, which means it binds to receptors and can activate them. L-alpha-methyldopa hydrochloride has high purity, and this product is for use in life science research only. It has CAS number 88439-9.

CD27 antibody was raised in Rabbit using Human CD27 as the immunogen

The SSRP1 antibody is a powerful tool in Life Sciences research. It specifically targets and binds to tumor necrosis factor-alpha (TNF-α) and imatinib, both of which are growth factors involved in various cellular processes. By binding to these proteins, the SSRP1 antibody can inhibit their activity and disrupt signaling pathways that promote cell growth and survival.

NGFRAP1 antibody was raised in Rabbit using Human NGFRAP1 as the immunogen

A synthetic peptide for use as a blocking control in assays to test for specificity of SCP2 antibody, catalog no. 70R-3015