Biochemicals and Reagents
Subcategories of "Biochemicals and Reagents"
- Biomolecules(98,575 products)
- By Biological Target(100,710 products)
- By Pharmacological Effects(6,937 products)
- Cryopreservatives(21 products)
- Desinfectants and Related Compounds(28 products)
- Hormones(421 products)
- Plant Biology(6,907 products)
- Secondary Metabolites(14,367 products)
Found 130493 products of "Biochemicals and Reagents"
Alpha-casozepine
CAS:CAS No. 117592-45-7 is an ion channel activator that belongs to the group of peptides. It is a high purity product with a purity of 99.5% and has been purified by HPLC. CAS No. 117592-45-7 activates voltage-gated sodium channels in neuronal tissue, which may be due to its ability to bind to the receptor site and activate it, or by binding to the protein and changing its conformation to allow ions through the channel pore. The specificity of this ligand has been shown using antibody inhibition assays on rat erythrocytes and human erythrocytes.
Formula:C60H94N14O16Purity:Min. 95%Molecular weight:1,267.5 g/molRef: 3D-SEA59245
Discontinued productDok-5 (263-275)
Catalogue peptide; min. 95% purity
Formula:C75H114N24O19Molecular weight:1,655.89 g/mol[Tyr0]-Hypercalcemia Malignancy Factor (1-40)
Catalogue peptide; min. 95% purity
Formula:C216H343N67O60Molecular weight:4,838.43 g/molGAP 26 trifluoroacetate salt
CAS:13-mer connexin mimetic peptide, composed of residue numbers 63-75 of the first extracellular loop of connexin 43 (gap junction blocker), containing the SHVR amino acid motif.Formula:C70H107N19O19SPurity:Min. 95%Molecular weight:1,550.78 g/molRef: 3D-FG110169
Discontinued productBig Gastrin-1, human
Catalogue peptide; min. 95% purity
Formula:C176H251N43O53SMolecular weight:3,849.30 g/molH-MFAMKTKAALAIWCPGYSETQINATQAMKKRRKRKVTTNKCLEQVSQLQGLWRRFNRPLLKQQ-OH
Peptide H-MFAMKTKAALAIWCPGYSETQINATQAMKKRRKRKVTTNKCLEQVSQLQGLWRRFNRPLLKQQ-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
MSP-1 P2, Malaria Merozoite Surface Peptide-1
Catalogue peptide; min. 95% purity
Formula:C116H190N32O35SMolecular weight:2,625 g/mol[Cys(Acm)20,31]-EGF (20-31)
Catalogue peptide; min. 95% purity
Formula:C63H98N16O23S3Molecular weight:1,543.77 g/mol[Arg0] Met-Enkephalin
Catalogue peptide; min. 95% purity
Formula:C33H47N9O8SMolecular weight:729.86 g/molPKA Inhibitor Substrate
Catalogue peptide; min. 95% purity
Formula:C61H108N25O22PMolecular weight:1,574.69 g/molCalcipotriol monohydrate
CAS:Calcipotriol is a synthetic vitamin D3 analog that has been shown to be effective in the treatment of bone cancer. It has a film-forming property and is used in pharmaceutical preparations as well as for wastewater treatment. Calcipotriol monohydrate is made by reacting calcipotriol with hydrochloric acid, which produces an ester bond between the hydroxyl group and the carboxylic acid group. The reaction also produces water, methanol, and methyl ethyl ether. Studies have shown that calcipotriol monohydrate has a chemical stability of over 30 days at room temperature, indicating it can be stored for long periods without degradation.
Formula:C27H40O3·H2OPurity:(%) Min. 96%Color and Shape:PowderMolecular weight:430.62 g/molRef: 3D-FC63561
Discontinued product(Pro18,Asp21)-Amyloid b-Protein (17-21) trifluoroacetate salt
CAS:Please enquire for more information about (Pro18,Asp21)-Amyloid b-Protein (17-21) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormula:C33H43N5O8Purity:Min. 95%Molecular weight:637.72 g/molRef: 3D-FP109385
Discontinued product[Trp11] Neurotensin (8-13)
Catalogue peptide; min. 95% purity
Formula:C40H65N13O7Molecular weight:840.05 g/molTryptophan Motif Peptide
Catalogue peptide; min. 95% purity
Formula:C35H41N11O7Molecular weight:727.79 g/molC-Reactive Protein (CRP) (77-82)
Catalogue peptide; min. 95% purity
Formula:C23H40N6O10Molecular weight:560.61 g/molMyristoylated ADP-Ribosylation Factor 6, myr-ARF6 (2-13)
Catalogue peptide; min. 95% purity
Formula:C74H128N16O18Molecular weight:1,529.95 g/molCEA Related, TYACFVSNL
Catalogue peptide; min. 95% purity
Formula:C46H68N10O14SMolecular weight:1,017.17 g/mol
![[Tyr0]-Hypercalcemia Malignancy Factor (1-40)](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00857.webp&w=3840&q=75)
![[Cys(Acm)20,31]-EGF (20-31)](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00265.webp&w=3840&q=75)
![[Arg0] Met-Enkephalin](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00699.webp&w=3840&q=75)
![[Trp11] Neurotensin (8-13)](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00688.webp&w=3840&q=75)
