Biochemicals and Reagents

<p>Human IgE antibody was raised in goat using purified human IgE as the immunogen.</p>

<p>Adenovirus antibody was raised in Mouse using the hexon group antigen of many ADV serotypes as the immunogen.</p>

<p>2-Amino-3-phosphonopropanoic acid is a chemical compound classified as a phosphonic acid derivative, which is obtained through synthetic processes in a laboratory setting. It acts as a selective antagonist of metabotropic glutamate receptors (mGluRs), specifically inhibiting the function of these receptors by blocking the normal action of the neurotransmitter glutamate, which is a critical excitatory neurotransmitter in the central nervous system. This blockade affects synaptic transmission and modulates neurological signals.</p>

<p>H-YPHTHLVQQANPR-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-YPHTHLVQQANPR-OH is provided at greater that &gt;95% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-YPHTHLVQQANPR-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-YPHTHLVQQANPR-OH at the technical inquiry form on this page</p>

<p>Peptide H-GAL^^QNIIPASTGAAK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide Ac-QVYSLIRPNENPAHK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Streptavidin Poly-HRP80 Conjugate (diluted to 2 µg/mL in stabilizer 85R-112).</p>

<p>Rabbit anti-human IgG (biotin) was raised in rabbit using human IgG F(ab')2 fragment as the immunogen.</p>

<p>Clostridum difficile toxin B antibody was raised in mouse using toxin B of Clostridium difficile as the immunogen.</p>

<p>The rise of antibiotic resistance has led to the search for new drug alternatives. Antimicrobial peptides (AMPs) have been identified as a lucrative area for molecule design. The polar fish Pleuronectes americanus expresses polyalanine peptide (pALA) which has been shown to be an AMP against biofilms, and gram-negative bacteria, while not being toxic to mammalian cells. pALA forms an alpha helical conformation that is effective at permeabilising the gram-negative bacteria membrane inducing fatal cell leakage. pALA provides a suitable model for molecule design to hopefully provide new drugs as we enter the post-antibiotic era.</p>

<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>

<p>Peptide H-DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGL^M^VGGV^V^IA-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Neutrophil Gelatinase-Associated Lipocalin (NGAL) Mouse Monoclonal Antibody is a life science tool for use in pharmaceutical and diagnostic applications. Please enquire for more information about Neutrophil Gelatinase-Associated Lipocalin (NGAL) Mouse Monoclonal Antibody including the price, delivery time and more detailed product information at the technical inquiry form on this page.</p>

<p>H-GALDLAKKSIHPDYV-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-GALDLAKKSIHPDYV-OH is provided at greater that &gt;80% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-GALDLAKKSIHPDYV-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-GALDLAKKSIHPDYV-OH at the technical inquiry form on this page</p>

<p>HSV2 antibody was raised in mouse using HSV2 as the immunogen.</p>

<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>

<p>The LYVE1 protein is a vital component in various biological processes. It plays a crucial role in the interaction between cells and their surrounding environment. This protein has been found to be involved in the growth and development of tissues, as well as in the regulation of immune responses.</p>

<p>Peptide H-V^V^GGL^V^ALR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Grossamide is a synthetic toll-like receptor (TLR) agonist that activates the immune system. It is used in nutrient solutions to stimulate plant growth. Grossamide has been shown to inhibit acetylcholinesterase, which is an enzyme that breaks down the neurotransmitter acetylcholine and can be used as a potential treatment for Alzheimer's disease. Grossamide has also been shown to have anti-cancer properties, including inhibiting prostate cancer cell growth and increasing tumor necrosis factor-α (TNF-α).</p>

<p>The GHK tripeptide has many attributes which can positively impact human health. GHK can improve tissue repair, exhibit anti-cancer and anti-inflammatory properties, suppress age related molecules and restore chronic obstructive pulmonary disease fibroblasts.The GHK tripeptide is found in the human plasma and binds copper. It exerts its effects through its ability to up regulate and downregulate 4,000 human genes. Due to its ability to protect and regenerate aspects of human health, GHK-Cu can be used in products for skin and hair.Specifically during skin regeneration GHK-Cu can promote the synthesis of collagen and glycosa-minoglycans, increase the rate of wound healing and the formation of blood vessels.A palmitoyl group is present on the N-terminus.</p>

<p>Peptide H-LSEPAELTDAVK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Anti-diabetic and anti-obesity drug.  We also have the heavy labelled material, CRB1301886.<br>Cymit Quimica provides this product solely for uses within the scope of any statute or law providing for an immunity, exemption, or exception to patent infringement (“Exempted Uses”), including but not limited to 35 U.S.C. § 271(e)(1) in the United States, the Bolar type exemption in Europe, and any corresponding exception to patent infringement in any other country. It is the sole responsibility of the purchaser or user of this product, and the purchaser or user of this product agrees to engage only in such Exempted Uses, and to comply with all applicable intellectual property laws and/or regulations. The purchaser of this product agrees to indemnify Cymit Quimica against all claims in connection with the performance of the respective commercial agreement (e.g. supply agreement) and possible infringements of intellectual property rights.</p>

<p>This sequence corresponds to the peptide bond between mammalian Lys27- (K27) linked Ub proteins- where (GG) corresponds to the C-terminus of the side chain appended Ub.K27-linked chains are less well characterised than other Ub chains, however they have been suggested as a marker of mitochondrial damage and have also been implicated in regulation of innate immunity and DNA repair.The C-terminal lysine residue of this peptide is isotopically labelled with carbon-13 (6) and nitrogen-15 (2), giving this peptide a mass increase of 8 compared to the unlabelled peptide.</p>

<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>

<p>Soluble guanylate cyclases (sGCs) are heterodimeric enzymes that convert GTP to 3',5'-cyclic GMP and pyrophosphate. Most complexes consist of an alpha subunit, such as alpha-2 (GUCY1A2), and a beta subunit, typically beta-1 (GUCY1B3). In the presence of magnesium or manganese ions, enzyme activity is stimulated by nitric oxide._x000D_<br>_x000D_<br>sGCs are the principal receptors for nitric oxide (NO) and NO-releasing drugs. sGC plays a role in several cardiovascular pathways. Diminished sGC function contributes to several conditions, including cardiovascular diseases. sGC-induced cGMP increase ultimately affects vascular relaxation, inhibition of platelet aggregation, and altered neurotransmission._x000D_<br>_x000D_<br>sGC GUCY1A2 is upregulated in several cancers and promotes tumorigenesis. GUCY1A2 regulation is particularly dysregulated in cervical, prostate, and gastric cancer. The expression of GUCY1A2 is being proposed as a prognostic indicator for the outcome of gastric cancer and prostate cancer.</p>

<p>H-HESAAMAET-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-HESAAMAET-OH is provided at greater that &gt;90% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-HESAAMAET-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-HESAAMAET-OH at the technical inquiry form on this page</p>

<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the category of rifamycins. It is highly effective in treating tuberculosis infections due to its bactericidal activity. By binding to DNA-dependent RNA polymerase, this drug inhibits bacterial growth, preventing transcription and replication. Extensive research has shown its high efficacy through various techniques such as transcription-quantitative polymerase chain and patch-clamp technique. Metabolized through different transformations, including hydrolysis, oxidation, reduction, or conjugation with glucuronic acid, it specifically targets Mycobacterium tuberculosis strains and inhibits their growth in culture. Tilmicosin is a macrolide antibiotic widely used in veterinary medicine for the treatment of respiratory disorders caused by bacteria like Clostridium perfringens. This antibiotic works by binding to the 50S ribosomal subunit, effectively inhibiting bacterial growth.</p>

<p>CD44 antibody was raised in mouse using T-cell blasts as the immunogen.</p>

<p>BNP-32, porcine is an N-terminal six amino acid extended form of BNP and henceforth is designated BNP-32. BNP and BNP-32 are found to be the major forms of BNP family in porcine brain.BNP-32 is a cardiac neurohormone and is secreted from the myoendocrine cells of the ventricles of the heart in response to volume expansion and pressure overload it has natriuretic, vasodilatory and cardiovascular homeostatic effects and suppresses the renin-angiotensin-aldosterone system.</p>

<p>Peptide H-LRPVAAEVYGTER^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide Ac-CSEGEKARKNIVLARRRP-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>H-LGPNGTQPQIANCSV-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-LGPNGTQPQIANCSV-OH is provided at greater that &gt;80% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-LGPNGTQPQIANCSV-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-LGPNGTQPQIANCSV-OH at the technical inquiry form on this page</p>

<p>Peptide H-VQSLQDEVAFLR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>H-TSGTNLTSEELRKRREAYFE-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-TSGTNLTSEELRKRREAYFE-OH is provided at greater that &gt;95% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-TSGTNLTSEELRKRREAYFE-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-TSGTNLTSEELRKRREAYFE-OH at the technical inquiry form on this page</p>

<p>HEXIM1 antibody was raised in mouse using recombinant Human Hexamethylene Bis-Acetamide Inducible 1</p>

<p>H-NSPVHGYWFR-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-NSPVHGYWFR-OH is provided at greater that &gt;85% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-NSPVHGYWFR-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-NSPVHGYWFR-OH at the technical inquiry form on this page</p>

<p>Metapneumovirus antibody was raised in mouse using matrix protein of human metapneumovirus as the immunogen.</p>

<p>H-ESNGQPEGAT-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-ESNGQPEGAT-OH is provided at greater that &gt;95% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-ESNGQPEGAT-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-ESNGQPEGAT-OH at the technical inquiry form on this page</p>

<p>The Lactoferrin antibody is a highly specialized protein that belongs to the group of antibodies used in Life Sciences. It plays a crucial role in various biological processes, including collagen synthesis and immune response. This Monoclonal Antibody specifically targets lactoferrin, a disulfide-bonded protein found in human serum. It has been extensively studied for its potential therapeutic applications, including its ability to neutralize tumor necrosis factor-related apoptosis-inducing ligand (TRAIL) and inhibit the growth of cancer cells. Additionally, this antibody has been used as a diagnostic tool to detect autoantibodies and alpha-fetoprotein in clinical settings. With its high specificity and affinity, the Lactoferrin antibody offers promising opportunities for research and medical applications.</p>

<p>BAM (8-22), the Bovine adrenal medulla 8-22 peptide is synthesised from proekephalin after it has undergone proteolytic cleavage. It can induce what is known as the 'itching' or 'scratching' response through activating, using an opioid independent mechanism, the G-protein coupled receptor MRGPRX1. This subsequently activates the Gαq/11 pathway and the cation channel TRPA1 histamine independent itch pathways.It is believed that BAM 8-22 can contribute to chronic itching in diseases such as cholestasis-related pruritus, in which patients are commonly diagnosed as having a reduction in bile flow.</p>

<p>Peptide H-SFEMLILGR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide Ac-CIHEEKPQDTISQ-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>

<p>An angiotensin II (Ang-II) receptor antagonist, the sequence of the angiotensin II anti-peptide has been derived from the anti-sense mRNA complementary to the human Ang-II mRNA. The anti-peptide shares 50% sequence homology with Ang-II and acts to inhibit some of Ang-II's biological activities.Ang-II is a key signalling peptide of the renin angiotensin system (RAS), which is involved in regulating blood pressure, cardiovascular function and energy balance. RAS activity is elevated in obesity and is widely studied in relation to lifestyle-related diseases. Ang-II is produced from angiotensinogen (AGT) via the intermediate angiotensin I (Ang-I). AGTis cleaved by the aspartyl-protease, renin, to produce Ang-I, which is then cleaved by the dicarboxyl-peptidase angiotensin converting enzyme (ACE). ACE removes a histidine and a leucine, from the C-terminus of Ang-I to form Ang-II.Ang-II exerts its affect by binding to the G-protein-coupled receptors- Ang II type 1 (AT1) and Ang II type 2 (AT2) receptors. Ang-II plays central roles in glucose metabolism and blood pressure. Increased levels of Ang-II have also been associated with Alzheimer's disease, and certain cancers including oesophageal squamous cell carcinoma (ESCC), brain cancers and breast cancer. The effects of Ang-II appear to be supressed by another branch of the RAS- the ACE2/Ang-(1-7)/Mas pathway.</p>

<p>Peptide H-TTNY^T-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-ATLTVDK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>

<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>

<p>Peptide Ac-LAQGAYRTAVDLESLASQLT-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>The BAP1 antibody is a highly specialized product in the field of Life Sciences. It belongs to the category of Antibodies and has various applications in medicine. This monoclonal antibody specifically targets BAP1, a glycoprotein involved in multiple cellular processes.</p>

<p>TGF-b3 Human Recombinant protein containing 112 amino acids.</p>

<p>Peptide H-TSDLIVLGLPWK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>H-TIGPALVSK-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-TIGPALVSK-OH is provided at greater that &gt;95% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-TIGPALVSK-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-TIGPALVSK-OH at the technical inquiry form on this page</p>

<p>Luteinizing hormone antibody was raised in mouse using human pituitary luteinizing hormone as the immunogen.</p>

<p>Peptide H-GTFAQLSELHCDK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>

<p>Peptide H-HSDPVWQVK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-VIGQGQQPSTAAR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>human IgA antibody was raised in mouse using immunoglobulin A Fc region as the immunogen.</p>

<p>The CREST antibody is a monoclonal antibody that specifically targets transthyretin, a protein involved in various biological processes. This antibody is widely used in Life Sciences research and diagnostics. It can be used in a variety of applications, including immunohistochemistry, western blotting, and ELISA assays. The CREST antibody has been shown to effectively bind to transthyretin in human hepatocytes and other cell types. It can also be used as an electrode for electrochemical analysis or as a tool for antibody-mediated cytotoxicity studies. With its high specificity and binding affinity, the CREST antibody is an essential tool for researchers studying transthyretin-related diseases and exploring therapeutic options.</p>

<p>The PKM2 antibody is a highly specialized monoclonal antibody that has a strong affinity for the pyruvate kinase M2 isoform. This antibody binds specifically to the receptor sites of PKM2, inhibiting its activity and preventing the conversion of phosphoenolpyruvate (PEP) to pyruvate. As a result, glycolysis is disrupted, leading to decreased ATP production and altered metabolic pathways.</p>

<p>Peptide H-K^VL^EHVVRV-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-QDNEILIFWSK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>H-TRVLAIERYLKDQQL-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-TRVLAIERYLKDQQL-OH is provided at greater that &gt;80% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-TRVLAIERYLKDQQL-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-TRVLAIERYLKDQQL-OH at the technical inquiry form on this page</p>

<p>Donkey anti Chicken IgY secondary antibody;(H + L) with AF594 photostable dye lable.</p>

<p>NT-proBNP protein is a vital component in the field of Life Sciences. It is an activated protein that is commonly used in research and diagnostic applications. NT-proBNP can be detected using both monoclonal and polyclonal antibodies, making it a versatile tool for scientists. This protein is often used as a growth factor in cell culture experiments, stimulating cellular proliferation and differentiation. Additionally, NT-proBNP has been found to be associated with certain autoimmune conditions, leading to the production of autoantibodies. Its ability to bind to globulin receptors on cells can also make it cytotoxic in certain circumstances.</p>

<p>Peptide H-YQTFFNPRT^FGSGE-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>H-SMQGSSRNISQDMTQTSGTN-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-SMQGSSRNISQDMTQTSGTN-OH is provided at greater that &gt;95% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-SMQGSSRNISQDMTQTSGTN-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-SMQGSSRNISQDMTQTSGTN-OH at the technical inquiry form on this page</p>

<p>COVID-19 Nucleocapsid protein recombinant Antigen</p>

<p>Peptide H-ALVLIAFAQYLQQCPFEDHVK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-GHDVTFYK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide LCBiot-DLDLEMLAPYIPMDDDFQL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Actin antibody (biotin) was raised in mouse using N-Terminal decapeptide of alpha smooth muscle isoform of actin, acetylated at the N-terminus, as the immunogen.</p>

<p>Temozolomide is an imidazotetrazine alkylating agent. It has anti-tumor activity against a broad spectrum of tumors, such as leukemias, lymphomas and solid tumors. Temozolomide induces G2/M arrest, preventing cells from entering mitosis and, therefore, apoptosis. As a drug resistance-modifying agent it is used for studying drug resistance mechanisms in glioblastoma cell lines.</p>

<p>C.I.Reactive Orange 13 is a reactive dye that can be used for the detection of bacterial strains, including Legionella pneumophila and Pseudomonas aeruginosa. The dye reacts with metal ions to form a precipitate, which can be detected by measuring the viscosity or turbidity of the solution. C.I.Reactive Orange 13 has been shown to bind to biomass from fungi and bacteria, which is why it is often used for monitoring water quality in wastewater treatment plants and for detecting microbial contamination in food products. C.I.Reactive Orange 13 is also an effective metal chelator that can be used for kinetic studies on borohydride reduction reactions involving iron and other transition metals.</p>

<p>Peptide H-AAAHVVEGAAGYAGHK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>The Influenza A antibody is a cholinergic antibody used in Life Sciences research. It is produced by hybridoma cells and has the ability to neutralize influenza viruses. This monoclonal antibody specifically targets and binds to specific epitopes on the surface of Influenza A viruses, preventing their entry into host cells and subsequent infection. The Influenza A antibody has been shown to be effective in inhibiting viral replication and spread, making it a valuable tool in studying the mechanisms of influenza infection and developing antiviral therapies. Additionally, this antibody has demonstrated neuroprotective properties and cytotoxic effects against cancer cells. It can also be used as a kinase substrate for studying signal transduction pathways. The Influenza A antibody is widely used in research laboratories for various applications, including immunohistochemistry, flow cytometry, and Western blotting. Its high specificity and affinity make it an essential tool for investigating the role of Influenza A viruses in disease progression</p>

<p>Inhibitor of COX-1 and COX-2 cyclooxygenases</p>

<p>Peptide H-DMQL^G-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-KITDFGRAK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-QGFGNVATNTDGK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-ADHVSFNGYER^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>H-DYAEVGR-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-DYAEVGR-OH is provided at greater that &gt;95% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-DYAEVGR-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-DYAEVGR-OH at the technical inquiry form on this page</p>

<p>FA-Gly-Leu-Ala-OH TFA is a high quality reagent that can be used for the synthesis of complex compounds. It is an intermediate for the production of fine chemicals and speciality chemicals, which are used as reaction components in the synthesis of versatile building blocks. This compound is also an excellent scaffold for research chemicals and useful as a building block in the synthesis of speciality chemicals.</p>

<p>Anti-ROBO1 antibody</p>

<p>H-DVAKKLGEMWNNTAA-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-DVAKKLGEMWNNTAA-OH is provided at greater that &gt;95% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-DVAKKLGEMWNNTAA-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-DVAKKLGEMWNNTAA-OH at the technical inquiry form on this page</p>

<p>Oxprenolol Hydrochloride (USP grade powder) chemical reference substance</p>

<p>SUAM-14746 is a peptide that inhibits the interactions between proteins. It has been shown to be an activator of the receptor for nerve growth factor, and it may also inhibit the activity of ion channels. SUAM-14746 is a research tool for studying protein interactions and antibody binding. It is a high purity product with CAS number 126898-09-7.</p>

<p>This C-terminal Sortagging peptide acts as a (oligo)glycine nucleophile in the final steps of a sortagging protein labelling reaction. This reaction results in the fluorescent moiety being attached to the C-terminus of the target protein or peptide.A substrate peptide containing the LPXTG motif is recognised and cleaved by the enzyme Sortase A (SrtA) from Staphylococcus aureus. The catalytic cysteine residue in the active site of SrtA, serves as a nucleophile to cleave the peptide bond between threonine and glycine of the substrate peptide. Cleavage results in the formation of a thioacyl intermediate between the substrate peptide and SrtA. This intermediate is then resolved by the N-terminus of this (oligo)glycine nucleophile peptide, resulting in the creation of a new peptide bond that links the substrate peptide to this peptide and its fluorescent dye.  This method of protein labelling is known as sortagging.This peptide contains Sulfocyanine3, which is a fluorescent yellow dye.</p>

<p>H-VGGVLVQPG-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-VGGVLVQPG-OH is provided at greater that &gt;90% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-VGGVLVQPG-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-VGGVLVQPG-OH at the technical inquiry form on this page</p>

<p>Cotinine-4 antibody was raised in rabbit using cotinine-4-BgG as the immunogen.</p>

<p>Peptide H-VLDALDSIK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>H-DDANVVRDRDLEVDTTLK-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-DDANVVRDRDLEVDTTLK-OH is provided at greater that &gt;95% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-DDANVVRDRDLEVDTTLK-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-DDANVVRDRDLEVDTTLK-OH at the technical inquiry form on this page</p>

<p>P12 is a cleavage product from the murine leukaemia virus (MLV) Gag protein and is essential for various steps in viral replication and during both early and late stages of murine leukaemia virus (MLV) infection.</p>

<p>H-LNLFSLDPDIDTLK-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-LNLFSLDPDIDTLK-OH is provided at greater that Flashpure (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-LNLFSLDPDIDTLK-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-LNLFSLDPDIDTLK-OH at the technical inquiry form on this page</p>

<p>HSV1 + HSV2 ICP27 antibody was raised in mouse using herpes simplex virus regulatory ICP27 as the immunogen.</p>

<p>Legionella pneumophila antibody was raised in mouse using LPS of all Legionella pneumophila strains tested as the immunogen.</p>

<p>JNK1 antibody was raised in sheep using purified JNK-1 yeast fusion protein as the immunogen.</p>

<p>H-PIAGNITCKSNITGI-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-PIAGNITCKSNITGI-OH is provided at greater that &gt;80% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-PIAGNITCKSNITGI-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-PIAGNITCKSNITGI-OH at the technical inquiry form on this page</p>

<p>Peptide Ac-LLVP-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>The CD44 antibody is a highly reactive monoclonal antibody that targets the CD44 protein, which is involved in cell adhesion and migration. It specifically recognizes the acid residues of CD44 and has been shown to have neuroprotective and neurotrophic effects. In Life Sciences research, this antibody is commonly used to study the role of CD44 in various cellular processes, including collagen binding and insulin signaling. It can also be used as a diagnostic tool for detecting autoantibodies in human serum. With its high specificity and affinity, the CD44 antibody is a valuable tool for researchers studying glial fibrillary acidic proteins and other related proteins.</p>

<p>Basic blue 9 is a reactive dye that has been used in wastewater treatment and biological treatment. The adsorption of Basic blue 9 is based on the basicity of the dye, which causes it to have high resistance to degradation by light. It has also been shown to be effective for removal of organic contaminants from water, due to its strong affinity for particle surfaces. Basic blue 9 is an acrylic acid ester with a fatty acid group that can be removed by hydrolysis. The adsorption mechanism of Basic blue 9 is related to kinetic data, which can be obtained through FT-IR spectroscopy.</p>

<p>CREB327/active transcription factor CREB-A (113-126), human.</p>

<p>H-GQSEVSAAQLQER-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-GQSEVSAAQLQER-OH is provided at greater that &gt;95% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-GQSEVSAAQLQER-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-GQSEVSAAQLQER-OH at the technical inquiry form on this page</p>

<p>C.I.Direct Black 32 is a diazonium salt with an average particle diameter of about 10 nm and a dichroic ratio of about 1.5. It is used in the manufacture of organic colorants, such as black, brown, blue, and green pigments. C.I.Direct Black 32 has been used as a model species to study the chemical reaction rate of small particles in solution and the kinetics of thermal decomposition of intramolecular hydrogen bonds in polyphenols at various temperatures. The material can be recycled by dissolving it in an organic solvent and precipitating it out with water or uv irradiation.br&gt;<br>C.I.Direct Black 32 has strong absorption properties in the ultraviolet region (UV) and is used for coloring plastics, paper products, textiles, printing ink, leathers, etc.br&gt;</p>

<p>LDLR antibody was raised in Rabbit using Human LDLR as the immunogen</p>

<p>LY2140023 is a novel drug that acts as an agonist of the metabotropic glutamate receptor mGlu2. It has been shown to be efficacious in animal models for the treatment of symptoms caused by disorders such as Parkinson’s disease, schizophrenia, and depression. LY2140023 is an oral prodrug that is metabolized into its active form in the liver. The drug may have potential for use in combination with other drugs to treat conditions such as Alzheimer's disease or stroke. LY2140023 has also been shown to increase locomotor activity and improve cognition in mice with a brain lesion. The long-term efficacy of the drug has not yet been established, but it has potential as a pharmacological agent for treating symptoms caused by disorders such as Parkinson’s disease, schizophrenia, and depression.</p>

<p>Ac-EPDLWPRIPDDREDSC-NH2 is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. Ac-EPDLWPRIPDDREDSC-NH2 is provided at greater that &gt;85% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer Ac-EPDLWPRIPDDREDSC-NH2 in bulk quantities in addition to our standard pack sizes.Please enquire for more information about Ac-EPDLWPRIPDDREDSC-NH2 at the technical inquiry form on this page</p>

<p>Peptide H-LAAFPEDR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Identification of cell penetrating conjugates has aided numerous areas of scientific development. The Drosophila transcription factor Antennapedia contains a homeodomain that can be internalised by cells to the cytoplasm and to the nucleus in a receptor-independent mechanism. The key residues for internalisation have been sequenced (RQIKIWFQNRRMKWKK), named penetratin, and used in several studies to aid entry of fusion proteins into cells.The full 60 amino acid homeodomain was fused to a T cell epitope of the influenza nucleoprotein and successfully internalised into T cells for presentation. The fragment known as penetratin was fused to a ligand for Grb-2 resulting in inhibition of downstream Grb-2 signalling events. Penetratin has also been used in vivo to prime cytotoxic T lymphocytes by conjugating short antigenic peptides to the CPP. Penetratin is provided here as a C-terminal amide with a C-terminal 5-carboxyfluorescein (5-FAM), a widely used green fluorescent tag often preferred over FITC due to its high stability- absorbance 492 (nm), 518 emission (nm).</p>

<p>Peptide H-NVPLPVIAELPPK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>HBcAg antibody was raised in mouse using purified HBcAg as the immunogen.</p>

<p>Peptide H-SSFTVQDLKPFTEYVFR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>H-LLAFLQYRRLRKGYA-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-LLAFLQYRRLRKGYA-OH is provided at greater that &gt;80% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-LLAFLQYRRLRKGYA-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-LLAFLQYRRLRKGYA-OH at the technical inquiry form on this page</p>

<p>Peptide Ac-ASRMEEVD-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>

<p>Transparent Red Fb is a hydrophobic, microsphere with a chloride-containing surface. It is made of a polyvinyl chloride (PVC) matrix containing a cationic dye and an anionic surfactant. The dye provides the color and the surfactant provides the fluorescence property. This product is used in surface active agent formulations, such as in laundry detergents.</p>

<p>This product is an antiserum targeting amino acids 37-43 of the amyloid beta-protein which is a key component of extracellular plaques found in the brains of patients with Alzheimer’s disease (AD). It may also be involved in the pathogenesis of other neurodegenerative diseases such as Huntington’s disease and Parkinson’s disease. Targeting this protein may be key to drug discovery and the treatment of AD and other diseases this protein is associated with. Furthermore amyloid beta peptides located in the cerebrospinal fluid are well known biomarkers used to diagnose AD. Although AD is not yet curable, an early diagnosis can be useful in that patients can be treated to delay or improve symptoms.<br>This product may also be used to detect amyloid beta protein in cell cultures, tissues, or fluids by immunohistochemistry or ELISA. It is suitable for use in life sciences, cell biology, and pharmacology studies.</p>

<p>Vnn1</p>

<p>Myosin antibody was raised in rabbit using purified human skeletal Myosin (heavy and light chains) as the immunogen.</p>

<p>The Influenza A antibody is a monoclonal antibody that specifically targets and neutralizes the influenza A virus. It is derived from human serum and has been extensively tested for its efficacy and safety. This antibody works by binding to the viral proteins on the surface of influenza A, preventing its entry into host cells and inhibiting viral replication.</p>

<p>VZV (nucleocapsid) antibody was raised in mouse using varicella zoster virus HZ strain as the immunogen.</p>

<p>Boc-Gln-Ala-Arg-pNA hydrochloride salt is a reagent, speciality chemical, and useful building block. It is used as a reaction component in the synthesis of complex compounds. Boc-Gln-Ala-Arg-pNA hydrochloride salt can be used as a versatile building block for the construction of new scaffolds. The high purity and quality of this compound make it an excellent choice for research chemicals and other fine chemicals.</p>

<p>The TNP antibody is a polyclonal antibody that specifically targets TGF-beta, a growth factor involved in various biological processes. This antibody has been shown to neutralize the activity of TGF-beta and inhibit its signaling pathway. Additionally, the TNP antibody can bind to alpha-fetoprotein and c-myc, two other important proteins involved in cellular growth and differentiation. This antibody is highly specific and has been extensively tested for its efficacy in various experimental models. It can be used as a research tool to study the role of TGF-beta in adipose tissue development, as well as in cancer progression and metastasis. The TNP antibody is available as both monoclonal and polyclonal forms, allowing researchers to choose the most suitable option for their experiments. With its high affinity and specificity, this antibody is an invaluable tool for studying the complex interactions between growth factors and their receptors.</p>

<p>Peptide Ac-CPTNDKAKAGNKP-NH2 PAB-404-871Y is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>This peptide is a PAR1-specific agonist that has been shown to produce cardioprotective effects in experimental models of myocardial infarction. It is a potent inhibitor of platelet aggregation and coagulation, and was found to be an effective antithrombotic agent in animal models. The peptide is also a potent vasodilator with potential for the treatment of hypertension.</p>

<p>Peptide Ac-SVFAQ-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>

<p>Peptide H-TITTDLLGSPFQEK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-DPLNVLKPR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide Ac-CKYDLSIRGFNKETA-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>RAGE antibody was raised in goat using a peptide; PKKPPQRLEWKLNTGRTE, as the immunogen.</p>

<p>Peptide H-ISTLNSLTLPALR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Nerve growth factor (NGF) is a neurotrophic factor and neuropeptide involved in the regulation of specific neurons through control of neuronal growth, maintenance, proliferation, and survival. NGF protein functions as the extracellular ligand for the NTRK1 or the NGFR receptors on the surface of neurons, initiating signalling cascades inside the cell. Binding of NGF causes neurons to mature and differentiate; additionally, NGF is critical in the survival of sympathetic and sensory neurons, as in the absence of NGF these cells will undergo apoptosis.NGF is capable of binding with two classes of receptors, both tropomyosin receptor kinase A (TrkA) and low-affinity NGF receptor (LNGFR) act as ligands for NGF, activating signalling cascades. These receptors are associated with neurodegenerative diseases, implying the potential of NGF as a therapeutic drug target.</p>

<p>Leu-Enkephalin is an endogenous opioid peptide that has been shown to produce analgesia, anti-inflammatory effects, and changes in locomotor activity. Leu-enkephalin binds to the kappa opioid receptor, which is found in high concentrations in the caudate putamen and hippocampal formation. The enkephalins are a family of basic proteins with two amino acids linked by a single amide bond. They are peptide hormones that act as neurotransmitters in the central nervous system and peripheral nervous system. Leu-enkephalin is a drug candidate for treatment of infectious diseases such as HIV and malaria. In addition, leu-enkephalin has been shown to have side effect profiles that are less severe than morphine or methadone.</p>

<p>Peptide H-DLYSGLNQR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>ASTX660 mesylate is a potent and selective inhibitor of the GABAA-receptor, which belongs to the class of ligands. It is an ion channel blocker that blocks chloride channels, leading to hyperpolarization of the membrane and inhibition of neuronal activity. This compound will selectively inhibit GABA receptor activity with little or no effect on other receptors, including glutamate receptor activity. ASTX660 mesylate is a high-purity research tool for studying protein interactions and cell biology.</p>

<p>Reactive blue 220 is a synthetic, reactive dye with aldehyde groups. It is used in gene analysis and as a stain in electron microscopy. Reactive blue 220 stains the nucleus of cells purple and the cytoplasm red. The color of the nuclei indicates the presence of active substances such as ATP, NADH, or GTP. This dye has been used to identify bacteria by their ability to produce CO2 from glucose when grown on an acidic nutrient solution with deionized water and sodium carbonate. The optical properties of this dye are dependent on pH level, becoming more red at lower pH levels (acidic).</p>

<p>Recombinant Human ANGPTL2 protein (His tag)</p>

<p>Peptide H-VPGVG^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>H-FVQGKDWGV-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-FVQGKDWGV-OH is provided at greater that &gt;98% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-FVQGKDWGV-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-FVQGKDWGV-OH at the technical inquiry form on this page</p>

<p>H-VVVGAGGV-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-VVVGAGGV-OH is provided at greater that &gt;95% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-VVVGAGGV-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-VVVGAGGV-OH at the technical inquiry form on this page</p>

<p>Peptide Ac-AGCMPYVRIPTA-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Inhibitor of DNA polymerase; anti-leukemic agent</p>

<p>Angiotensin II (Ang-II) is a key signalling peptide of the renin angiotensin system (RAS). The RAS is involved in regulating functions such as blood pressure, cardiovascular function and energy balance. RAS activity is elevated in obesity is widely studied in relation to lifestyle-related diseases.Ang-II is produced from angiotensinogen (AGT) via the intermediate angiotensin I (Ang-I). AGTis cleaved by the aspartyl-protease, renin, to produce Ang-I, which is then cleaved by the dicarboxyl-peptidase angiotensin converting enzyme (ACE), which removes a histidine and a leucine, from the C-terminus of Ang-I to form Ang-II.Ang-II exerts its affect by binding to the G-protein-coupled receptors- Ang-II type 1 (AT1) and Ang-II type 2 (AT2) receptors. Ang-II plays central roles in glucose metabolism and blood pressure. Increased levels of Ang-II have also been associated with Alzheimer's disease, and certain cancers including oesophageal squamous cell carcinoma (ESCC), brain cancers and breast cancer. The effects of Ang-II appear to be supressed by another branch of the RAS- the ACE2/Ang-(1-7)/Mas pathway.The valine residue at position 3 and the isoleucine residue at position 5 of this peptide are isotopically labelled with carbon-13 (11) and nitrogen-15 (2), giving this peptide a mass increase of 13 compared to the unlabelled peptide.</p>

<p>CHGB antibody was raised in Rabbit using Human CHGB as the immunogen</p>

<p>PPIL2 antibody was raised using a synthetic peptide corresponding to a region with amino acids MKIIDPDEEKAKQDPSYYLKNTNAETRETLQELYKEFKGDEILAATMKAP</p>

<p>HPV16 antibody was raised in mouse using papilloma virus type 16 as the immunogen.</p>

<p>Histone H3 (32-47) is derived from Histone 3 (H3) which is one of the four core histones (H2A, H2B, H3 and H4) fundamental in compacting eukaryotic DNA into a structure known as the nucleosome. The nucleosome arises when 147 base pairs of DNA wrap around a H3-H4 tetramer and two H2A-H2B dimers, forming the histone octamer core. Both H4 and H3 are highly conserved and perform roles in binding to segments of DNA which enter and leave the nucleosome and in chromatin formation. Similar to the other core histone, H3 has a globular domain and a flexible N-terminal domain, 'histone tail' which can undergo modifications such as acetylation, methylation, phosphorylation and ubiquitination. Due to histones containing a large number of lysine and arginine residues they have a positive net charge which interacts in an electrostatic manner with the negatively charged phosphate groups in DNA. The transcriptional activation or silencing of the chromatin is controlled by ATP-dependent chromatin remodelling factors and histone modifying enzymes which target histone proteins. Both processes function to alter the positioning of the nucleosome, allowing the DNA it to be either available or inaccessible to the transcription machinery.</p>

<p>Peptide Ac-KKKKKRFSFKKSFKLSGFSFKKNKK-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-GTGNLELVAVR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Chromogranin A antibody was raised in mouse using human pheochromocytoma as the immunogen.</p>

<p>The beta Galactosidase antibody is a specific antibody used in Life Sciences for various applications. It is commonly used in research and diagnostics to detect the presence of beta-galactosidase, an enzyme that hydrolyzes lactose into glucose and galactose. This antibody can be used in techniques such as solid-phase DNA hybridization, chemical detection, and enzyme complex formation. The beta Galactosidase antibody has a high affinity for the enzyme and forms a stable antibody-enzyme complex, allowing for easy detection and quantification. It is available as a monoclonal antibody, ensuring high specificity and consistency in results. This antibody is suitable for use in various formats, including microtiter plates, making it versatile for different experimental setups. With its excellent performance and reliability, the beta Galactosidase antibody is an essential tool for researchers in the field of Life Sciences.</p>

<p>HIV1 p24 antibody was raised in mouse using purified HIV1 p24 as the immunogen.</p>

<p>MBP protein is a cytotoxic and neutralizing protein that plays a crucial role in various life sciences applications. It acts as an acetyltransferase, transferring an acetyl group from acetyl-CoA to target proteins. MBP protein is commonly used in research as a marker for myelin-producing cells and has been extensively studied for its cholinergic properties. It can bind to specific receptors, such as the interleukin-6 receptor, and modulate signaling pathways involved in cell growth and differentiation. Additionally, MBP protein has been used in genotoxicity studies to evaluate the potential effects of various substances on DNA damage. With its unique properties and diverse applications, MBP protein is a valuable tool for researchers in the field of life sciences.</p>

<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>

<p>H-FQLPGQK-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-FQLPGQK-OH is provided at greater that &gt;95% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-FQLPGQK-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-FQLPGQK-OH at the technical inquiry form on this page</p>

<p>CREB327/active transcription factor CREB-A (113-126) Biotinyl, human.</p>

<p>Purified recombinant CKMM protein</p>

<p>Peptide H-NIQSLEVIGK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-TWNDPSVQQDI^K^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>H-VYLKTNAFL-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-VYLKTNAFL-OH is provided at greater that &gt;95% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-VYLKTNAFL-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-VYLKTNAFL-OH at the technical inquiry form on this page</p>

<p>Peptide H-EIYKRWII^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>