Biochemicals and Reagents
Biochemicals and reagents are fundamental substances for research and development in fields such as biotechnology, molecular biology, pharmacology, and medicine. These products are essential for a variety of applications, including compound synthesis, biological sample analysis, metabolic process research, and drug production. At CymitQuimica, we offer a wide selection of high-quality, high-purity biochemicals and reagents suitable for various scientific and industrial needs. Our catalog includes enzymes, antibodies, nucleic acids, amino acids, and many other products, all designed to support researchers and professionals in their research and development projects, ensuring reliable and reproducible results.
Subcategories of "Biochemicals and Reagents"
- Biomolecules(99,116 products)
- By Biological Target(99,075 products)
- By Pharmacological Effects(6,785 products)
- Cryopreservatives(21 products)
- Desinfectants and Related Compounds(28 products)
- Hormones(346 products)
- Plant Biology(6,700 products)
- Secondary Metabolites(14,220 products)
Found 130578 products of "Biochemicals and Reagents"
Sort by
Purity (%)
0
100
|
0
|
50
|
90
|
95
|
100
H-PQPEQPFPQ-OH
<p>Peptide H-PQPEQPFPQ-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-RRRR-OH
<p>Peptide H-RRRR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-QPLPDCCRQKTCSCRLYELLHGAGNHAAGILTL-OH
<p>Peptide H-QPLPDCCRQKTCSCRLYELLHGAGNHAAGILTL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-IQQDPALPTREGKER-OH
<p>Peptide H-IQQDPALPTREGKER-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-SQVTNPANI-OH
<p>Peptide H-SQVTNPANI-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-EGSFQPSQE-OH
<p>Peptide H-EGSFQPSQE-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-SHALQLNNR-OH
<p>Peptide H-SHALQLNNR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-GHSFADPASNLGLEDIIRKALMGSF-OH
<p>Peptide H-GHSFADPASNLGLEDIIRKALMGSF-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-EIIDLVLDR-OH
<p>Peptide H-EIIDLVLDR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-GGGDGSFSGFGDGSFSGFG-OH
<p>Peptide H-GGGDGSFSGFGDGSFSGFG-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-SPRWYFYYL-OH
<p>Peptide H-SPRWYFYYL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-NMQALSMPVT-OH
<p>Peptide H-NMQALSMPVT-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-AIPPKKNQDKTEIPTINT-OH
<p>Peptide H-AIPPKKNQDKTEIPTINT-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-VTWFHAIHVSGTNGT-OH
<p>Peptide H-VTWFHAIHVSGTNGT-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-AGSLQPLALEGSLQKRG-OH
<p>Peptide H-AGSLQPLALEGSLQKRG-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-GSFPWQAK-OH
<p>Peptide H-GSFPWQAK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-VVGARGVGK-OH
<p>Peptide H-VVGARGVGK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-VTAPRTLLL-OH
<p>Peptide H-VTAPRTLLL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-VV-OH
<p>Peptide H-VV-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-RDDP-OH
<p>Peptide H-RDDP-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-GIGAVLKVLTTGLPALISWIKRKRQQC-OH
<p>Peptide H-GIGAVLKVLTTGLPALISWIKRKRQQC-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-RAPQTGIVDECCFR-OH
<p>Peptide H-RAPQTGIVDECCFR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-KDSWTVNDIQKLVGK-OH
<p>Peptide H-KDSWTVNDIQKLVGK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>N-(tert-Butoxycarbonyl)-L-serine β-Lactone
CAS:Formula:C8H13NO4Purity:>98.0%(N)Color and Shape:White to Almost white powder to crystalMolecular weight:187.20H-GSDPHLPTL-OH
<p>Peptide H-GSDPHLPTL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-YNGLVTGTR-OH
<p>Peptide H-YNGLVTGTR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-SNIHVVNEWIANDISSTK-OH
<p>Peptide H-SNIHVVNEWIANDISSTK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-ADQDNPWRAYLDLLFPTDTLLLDLLWCG-OH
<p>Peptide H-ADQDNPWRAYLDLLFPTDTLLLDLLWCG-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Molecular weight:3,314 g/molSARS-CoV-1 S1 Spike Antigen Mouse Monoclonal Antibody
<p>SARS-CoV-1 S1 Spike Antigen Mouse Monoclonal Antibody is a life science tool for use in pharmaceutical and diagnostic applications. Please enquire for more information about SARS-CoV-1 S1 Spike Antigen Mouse Monoclonal Antibody including the price, delivery time and more detailed product information at the technical inquiry form on this page.</p>Purity:>90% By Sds-Page.H-VNFYAWK-OH
<p>Peptide H-VNFYAWK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-YRPGTVALR-OH
<p>Peptide H-YRPGTVALR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-FLLCFCVLL-OH
<p>Peptide H-FLLCFCVLL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-CDITQVMSKLDRRSQL-OH
<p>Peptide H-CDITQVMSKLDRRSQL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Measles (Rubeola) ELISA Antigen, High Specific Activity
<p>Measles, or rubeola, is a highly contagious viral disease characterized by fever, cough, runny nose, red eyes, and a distinctive skin rash. Despite the availability of effective vaccines, measles continues to pose a serious public health challenge, particularly in low-resource regions such as parts of Africa and Southeast Asia. The virus spreads through respiratory droplets and can remain infectious in the air or on surfaces for several hours.<br>Timely and accurate detection of measles is critical for controlling outbreaks. Antigen-based assays are essential tools for confirming infection, providing rapid and reliable identification of measles-specific immune responses. Early diagnosis not only enables appropriate medical care but also helps prevent further transmission of this highly contagious virus. This Measles (Rubeola) Virus Antigen has potential for use in the development of serology assays and as a research tool looking into vaccines and investigating pathogen-host interactions</p>Purity:Min. 95%(2Z)-Afatinib
CAS:<p>Afatinib is a potent, selective, and ATP-competitive inhibitor of EGFR. It blocks the phosphorylation of tyrosine residues on the extracellular domain of EGFR, thereby inhibiting receptor activation and causing inhibition of tumor cell proliferation in vitro and in vivo. Afatinib has been used as a research tool to study the function and regulation of EGFR signaling pathways. Afatinib has also been shown to block activation of the human transient receptor potential channel TRPM8 by menthol, which may be due to its ability to inhibit protein interactions with the channel.</p>Formula:C24H25ClFN5O3Purity:Min. 95%Molecular weight:485.9 g/molH-TLADLTLLDSPIK-OH
<p>Peptide H-TLADLTLLDSPIK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-LHVDPENFK-OH
<p>Peptide H-LHVDPENFK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-EQTDAAVKNWMTQTLL-OH
<p>Peptide H-EQTDAAVKNWMTQTLL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-IADPEHDHTGFLTEYVATR-OH
<p>Peptide H-IADPEHDHTGFLTEYVATR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-FPDENFK-OH
<p>Peptide H-FPDENFK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-DFDQNQGEVVK-OH
<p>Peptide H-DFDQNQGEVVK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-TDELFQIEGLKEELAYLR-OH
<p>Peptide H-TDELFQIEGLKEELAYLR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-FLYALALLL-OH
<p>Peptide H-FLYALALLL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-LPFDKPTIM-OH
<p>Peptide H-LPFDKPTIM-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-VYAETKHFL-OH
<p>Peptide H-VYAETKHFL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Streptococcus Group A antibody
<p>Please enquire for more information about Streptococcus Group A antibody including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>H-GVNLPGAAVDLPAVSEK-OH
<p>Peptide H-GVNLPGAAVDLPAVSEK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-ELAAKLVAL-OH
<p>Peptide H-ELAAKLVAL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-RRETQV-OH
<p>Peptide H-RRETQV-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-TENNDHINLK-OH
<p>Peptide H-TENNDHINLK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-QVSDLISVLR-OH
<p>Peptide H-QVSDLISVLR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-SKIGSTENLK-OH
<p>Peptide H-SKIGSTENLK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-ATDALMTGY-OH
<p>Peptide H-ATDALMTGY-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-IQEVAGSLIFR-OH
<p>Peptide H-IQEVAGSLIFR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-EQVTNVGGAVVTGVTAVAQK-OH
<p>Peptide H-EQVTNVGGAVVTGVTAVAQK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-GAGTDDHTLIR-OH
<p>Peptide H-GAGTDDHTLIR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-YGRKKRRQRRRVILLKDHTLEYPVF-OH
<p>Peptide H-YGRKKRRQRRRVILLKDHTLEYPVF-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-NSEPVYIQPISTRSL-OH
<p>Peptide H-NSEPVYIQPISTRSL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-RLSALESRV-OH
<p>Peptide H-RLSALESRV-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-VQVLLGAHSLSQPEPSK-OH
<p>Peptide H-VQVLLGAHSLSQPEPSK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-ALGSTAPPV-OH
<p>Peptide H-ALGSTAPPV-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-GSRAHSSHLKSKKGQSTSRHKK-OH
<p>Peptide H-GSRAHSSHLKSKKGQSTSRHKK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-RTYTYEKL-OH
<p>Peptide H-RTYTYEKL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-LSSPAVITDK-OH
<p>Peptide H-LSSPAVITDK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-APVLFFDR-OH
<p>Peptide H-APVLFFDR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Cyclosporin B
CAS:<p>Cyclosporin B is an antifungal and immunosuppressive cyclic peptide, which is derived from the fungus *Tolypocladium inflatum*. The compound is a member of the cyclosporin family, characterized by cyclic polypeptides with a unique arrangement of amino acids that enable its biological activity. Though its precise mode of action is not completely delineated, it is observed to influence cell growth and viability by potentially disrupting cellular communication or signal transduction pathways.</p>Formula:C61H109N11O12Purity:Min. 95%Color and Shape:PowderMolecular weight:1,188.59 g/molH-VQNRFNSAITNLGNT-OH
<p>Peptide H-VQNRFNSAITNLGNT-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-LSNNNPTTIMRPPVAQN-OH
<p>Peptide H-LSNNNPTTIMRPPVAQN-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-YEQHKITSY-OH
<p>Peptide H-YEQHKITSY-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-NGNNVNGNRNNN-OH
<p>Peptide H-NGNNVNGNRNNN-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-LFDQAFGVPR-OH
<p>Peptide H-LFDQAFGVPR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-VLDALDSIK-OH
<p>Peptide H-VLDALDSIK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Amoxicillin Humanized Recombinant Human Monoclonal Antibody
<p>Amoxicillin Humanized Recombinant Human Monoclonal Antibody</p>H-HKHGHGHGKHKNKGKKNGKH-OH
<p>Peptide H-HKHGHGHGKHKNKGKKNGKH-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Chloromethyl Polystyrene Resin cross-linked with 1% DVB (200-400mesh) (0.8-1.3mmol/g)
CAS:Color and Shape:SolidH-CSDTDSTELASIL-OH
<p>Peptide H-CSDTDSTELASIL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-MVTAVASALSSR-OH
<p>Peptide H-MVTAVASALSSR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-KWKLFKKIEKVGQRVRDAVISAGPAVATVAQATALAK-OH
<p>Peptide H-KWKLFKKIEKVGQRVRDAVISAGPAVATVAQATALAK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-ANYKFTLV-OH
<p>Peptide H-ANYKFTLV-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-ITFEDLLDYYK-OH
<p>Peptide H-ITFEDLLDYYK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Molecular weight:1,419.6 g/molH-DDDDDDDDDD-OH
<p>Peptide H-DDDDDDDDDD-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-LLIYDASNLETGVPSR-OH
<p>Peptide H-LLIYDASNLETGVPSR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-NGSLQCRICI-OH
<p>Peptide H-NGSLQCRICI-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-ESEH-OH
<p>Peptide H-ESEH-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-VYLKTNVFL-OH
<p>Peptide H-VYLKTNVFL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-QIFGDYK-OH
<p>Peptide H-QIFGDYK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Fmoc-PNA-C(Bhoc)-OH
CAS:Formula:C39H35N5O8Purity:>98.0%(HPLC)(qNMR)Color and Shape:White to Light yellow powder to crystalMolecular weight:701.74H-ADAGFIKQY-OH
<p>Peptide H-ADAGFIKQY-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-TLLSNLEEAK-OH
<p>Peptide H-TLLSNLEEAK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-QDAYNAAGGHNAVFN-OH
<p>Peptide H-QDAYNAAGGHNAVFN-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-LFCASDAKAY-OH
<p>Peptide H-LFCASDAKAY-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-GLSPNLNRFL-OH
<p>Peptide H-GLSPNLNRFL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-AAVPDAVGK-OH
<p>Peptide H-AAVPDAVGK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-KRPPGFSPF-OH
<p>Peptide H-KRPPGFSPF-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-RVY-OH
<p>Peptide H-RVY-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-LTASLLI-OH
<p>Peptide H-LTASLLI-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-YLGPFNGLDK-OH
<p>Peptide H-YLGPFNGLDK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-IATEAIENFR-OH
<p>Peptide H-IATEAIENFR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-KLVVVGAVGV-OH
<p>Peptide H-KLVVVGAVGV-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-SEGATPQDL-OH
<p>Peptide H-SEGATPQDL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-VYNTVISYI-OH
<p>Peptide H-VYNTVISYI-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-AAFDDAIAELDTLSEESYK-OH
<p>Peptide H-AAFDDAIAELDTLSEESYK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Balixafortide
CAS:<p>Balixafortide is a peptide that interacts with the GABA-A receptor, which is a protein that mediates the effects of the neurotransmitter GABA. It has been shown to be an activator of this receptor and to have high purity. Balixafortide is used as a research tool in cell biology and pharmacology.</p>Formula:C84H118N24O21S2Purity:Min. 95%Molecular weight:1,864.1 g/molH-GTFAQLSELHCDK-OH
<p>Peptide H-GTFAQLSELHCDK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Bosutinib
CAS:<p>Inhibitor of Abl and Src kinases; anti-proliferative; antineoplasticÂ</p>Formula:C26H29Cl2N5O3Purity:Min. 95%Color and Shape:Off-White PowderMolecular weight:530.45 g/molH-RLGMFNIQHCK-OH
<p>Peptide H-RLGMFNIQHCK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-DPPSSLLR-OH
<p>Peptide H-DPPSSLLR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-KYLQVASHV-OH
<p>Peptide H-KYLQVASHV-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-ALQDQLVLVAAK-OH
<p>Peptide H-ALQDQLVLVAAK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-DLDLEMLAPYIPMDDDFQL-OH
<p>Peptide H-DLDLEMLAPYIPMDDDFQL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Berberine Sulfate
CAS:Formula:C40H36N2O12SPurity:>98.0%(T)(HPLC)Color and Shape:Light yellow to Yellow powder to crystalMolecular weight:768.79H-IQASFR-OH
<p>Peptide H-IQASFR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-VLYENQKLI-OH
<p>Peptide H-VLYENQKLI-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>SB 271046 hydrochloride
CAS:<p>5-HT6 serotonin receptor antagonist; anti-convulsant</p>Formula:C20H22CIN3O3S2·HClPurity:Min. 95%Molecular weight:591.91 g/molL-Norleucine
CAS:Formula:C6H13NO2Purity:>98.0%(T)(HPLC)Color and Shape:White to Almost white powder to crystalMolecular weight:131.18H-SYIGSINAI-OH
<p>Peptide H-SYIGSINAI-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-GISL-OH
<p>Peptide H-GISL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-MIAQYTSAL-OH
<p>Peptide H-MIAQYTSAL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-DIQMTQSPSSLSASVGDRVTITCR-OH
<p>Peptide H-DIQMTQSPSSLSASVGDRVTITCR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-LSFLIPAGWVLSHLDHYKRSSAA-OH
<p>Peptide H-LSFLIPAGWVLSHLDHYKRSSAA-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-QLYHFLQIPTHEEHLFYVLS-OH
<p>Peptide H-QLYHFLQIPTHEEHLFYVLS-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-LLALWGPDPAAAFVN-OH
<p>Peptide H-LLALWGPDPAAAFVN-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-SFEDIHQYR-OH
<p>Peptide H-SFEDIHQYR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-FKDPNAPK-OH
<p>Peptide H-FKDPNAPK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-IQKEIDRLNEVAKNLNESLI-OH
<p>Peptide H-IQKEIDRLNEVAKNLNESLI-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-LRMRRCRRM-OH
<p>Peptide H-LRMRRCRRM-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-ILDEMRKEL-OH
<p>Peptide H-ILDEMRKEL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Bivalirudin
<p>Peptide Bivalirudin is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-CFITKGLGISYGRKK-OH
<p>Peptide H-CFITKGLGISYGRKK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-DLPLTFGGGTK-OH
<p>Peptide H-DLPLTFGGGTK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-AVLVDLEPGTMDSVR-OH
<p>Peptide H-AVLVDLEPGTMDSVR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-EQEQMISCKFNMTGL-OH
<p>Peptide H-EQEQMISCKFNMTGL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-YNLGLDLR-OH
<p>Peptide H-YNLGLDLR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-KYSPSNVKI-OH
<p>Peptide H-KYSPSNVKI-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-SSNYR-OH
<p>Peptide H-SSNYR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-NFFRMVISNPAAT-OH
<p>Peptide H-NFFRMVISNPAAT-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-FIAGLIAIV-OH
<p>Peptide H-FIAGLIAIV-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-DLAQCFFCFKELEGW-OH
<p>Peptide H-DLAQCFFCFKELEGW-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-FIFSILVLA-OH
<p>Peptide H-FIFSILVLA-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-AAVDLSHFL-OH
<p>Peptide H-AAVDLSHFL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-GGPLDGTYR-OH
<p>Peptide H-GGPLDGTYR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-HLGGSQQLLHNK-OH
<p>Peptide H-HLGGSQQLLHNK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-CSEY-OH
<p>Peptide H-CSEY-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-GLAWEWWRTVI-OH
<p>Peptide H-GLAWEWWRTVI-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-AVGITYTWTRLYASVLTGSLV-OH
<p>Peptide H-AVGITYTWTRLYASVLTGSLV-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-LHDFRHQIL-OH
<p>Peptide H-LHDFRHQIL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-IAIDLFK-OH
<p>Peptide H-IAIDLFK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-LLILAFSR-OH
<p>Peptide H-LLILAFSR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-LILRGSVAHKSCLPACV-OH
<p>Peptide H-LILRGSVAHKSCLPACV-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-VYAWNRKRI-OH
<p>Peptide H-VYAWNRKRI-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-APQPELPYPQPGS-OH
<p>Peptide H-APQPELPYPQPGS-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-ISASAEELR-OH
<p>Peptide H-ISASAEELR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-LPVSPRLQL-OH
<p>Peptide H-LPVSPRLQL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-HHHAGYEQF-OH
<p>Peptide H-HHHAGYEQF-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-HIRL-OH
<p>Peptide H-HIRL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Neu5Acα(2-3)Galβ(1-4)Glc-β-pNP
CAS:Formula:C29H42N2O21Purity:>97.0%(HPLC)Color and Shape:White to Light yellow to Green powder to crystalineMolecular weight:754.65H-LVESLPQEIK-OH
<p>Peptide H-LVESLPQEIK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Melperone
CAS:Formula:C16H22FNOPurity:>95.0%(GC)Color and Shape:White to Light yellow to Light orange powder to crystalMolecular weight:263.36H-EPQVYTLPPSR-OH
<p>Peptide H-EPQVYTLPPSR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-LIITPGTFK-OH
<p>Peptide H-LIITPGTFK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Coronavirus (SARS-CoV-2) Nucleoprotein - Purified
<p>Recombinant SARS-CoV-2 Nucleocapsid Protein with a 6xHIS tag was expressed in E. coli and purified by nickel affinity chromatography.</p>H-LLGIETPLPK-OH
<p>Peptide H-LLGIETPLPK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Tolrestat
CAS:<p>Aldose reductase AKR1B10 inhibitor; hepatotoxic</p>Formula:C16H14F3NO3SPurity:Min. 95%Molecular weight:357.35 g/molH-NFPSPVDAAFR-OH
<p>Peptide H-NFPSPVDAAFR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-HHHHHSAAAAAGISQAVHAAHAEINEAGR-OH
<p>Peptide H-HHHHHSAAAAAGISQAVHAAHAEINEAGR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-SKMRMATPLLMQ-OH
<p>Peptide H-SKMRMATPLLMQ-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-KKKKKKKKKKKKKKK-OH
<p>Peptide H-KKKKKKKKKKKKKKK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-AILNYIASK-OH
<p>Peptide H-AILNYIASK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-SQAPLPCVL-OH
<p>Peptide H-SQAPLPCVL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-CYGVSATKL-OH
<p>Peptide H-CYGVSATKL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-YQGFIFDIVTK-OH
<p>Peptide H-YQGFIFDIVTK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-QCRPWRKNACCSTNT-OH
<p>Peptide H-QCRPWRKNACCSTNT-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-IPQSLDSWWTSL-OH
<p>Peptide H-IPQSLDSWWTSL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-DPEGVPPLLVSQQAK-OH
<p>Peptide H-DPEGVPPLLVSQQAK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-CGKYSRHRLVPLLDRPF-OH
<p>Peptide H-CGKYSRHRLVPLLDRPF-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-GLDSEESYPYEAK-OH
<p>Peptide H-GLDSEESYPYEAK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-DTYRYI-OH
<p>Peptide H-DTYRYI-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>4-Amino-N-(tert-butoxycarbonyl)-D-phenylalanine
CAS:Formula:C14H20N2O4Purity:>97.0%(HPLC)Color and Shape:Light orange to Yellow to Green powder to crystalMolecular weight:280.32H-HPVGEADYFEY-OH
<p>Peptide H-HPVGEADYFEY-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-GIWIPDGENVK-OH
<p>Peptide H-GIWIPDGENVK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-STQAAINQINGK-OH
<p>Peptide H-STQAAINQINGK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-IGVSNRDFV-OH
<p>Peptide H-IGVSNRDFV-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-TLRSP-OH
<p>Peptide H-TLRSP-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-ALYLVCGER-OH
<p>Peptide H-ALYLVCGER-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-EALDESIPPVSFWR-OH
<p>Peptide H-EALDESIPPVSFWR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-PQRERRRKKR-OH
<p>Peptide H-PQRERRRKKR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-SVINDPIYK-OH
<p>Peptide H-SVINDPIYK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-SGDSEVYQLGDVSQK-OH
<p>Peptide H-SGDSEVYQLGDVSQK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-HNTNGVTAACSHE-OH
<p>Peptide H-HNTNGVTAACSHE-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-RYLLEAKEAENITTG-OH
<p>Peptide H-RYLLEAKEAENITTG-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-ELNNN-OH
<p>Peptide H-ELNNN-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-EIWTHSTKV-OH
<p>Peptide H-EIWTHSTKV-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-NLLRLTG-OH
<p>Peptide H-NLLRLTG-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-FEVQVTVPK-OH
<p>Peptide H-FEVQVTVPK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-CRGDS-OH
<p>Peptide H-CRGDS-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-NLSSAEVVV-OH
<p>Peptide H-NLSSAEVVV-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-VGKAMYAPPIRGQIR-OH
<p>Peptide H-VGKAMYAPPIRGQIR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-DSALGFLR-OH
<p>Peptide H-DSALGFLR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-HGATVLTALGGILK-OH
<p>Peptide H-HGATVLTALGGILK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>
