Biochemicals and Reagents
Biochemicals and reagents are fundamental substances for research and development in fields such as biotechnology, molecular biology, pharmacology, and medicine. These products are essential for a variety of applications, including compound synthesis, biological sample analysis, metabolic process research, and drug production. At CymitQuimica, we offer a wide selection of high-quality, high-purity biochemicals and reagents suitable for various scientific and industrial needs. Our catalog includes enzymes, antibodies, nucleic acids, amino acids, and many other products, all designed to support researchers and professionals in their research and development projects, ensuring reliable and reproducible results.
Subcategories of "Biochemicals and Reagents"
- Biomolecules(99,104 products)
- By Biological Target(99,074 products)
- By Pharmacological Effects(6,784 products)
- Cryopreservatives(21 products)
- Desinfectants and Related Compounds(28 products)
- Hormones(346 products)
- Plant Biology(6,693 products)
- Secondary Metabolites(14,218 products)
Found 130576 products of "Biochemicals and Reagents"
Sort by
Purity (%)
0
100
|
0
|
50
|
90
|
95
|
100
H-SIIQFEHL-OH
<p>Peptide H-SIIQFEHL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Anti-Leptospira monoclonal antibody
<p>Please enquire for more information about Anti-Leptospira monoclonal antibody including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>H-SVNCAKKIV-OH
<p>Peptide H-SVNCAKKIV-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-HDRVNWEYI-OH
<p>Peptide H-HDRVNWEYI-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-RRWIQLGLQK-OH
<p>Peptide H-RRWIQLGLQK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-SRLSKVAPVIKARMMEYGTT-OH
<p>Peptide H-SRLSKVAPVIKARMMEYGTT-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-ASRELERFAVNPGLL-OH
<p>Peptide H-ASRELERFAVNPGLL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-EKKYFAATQFEPLAARL-OH
<p>Peptide H-EKKYFAATQFEPLAARL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-SPNGTIQNIL-OH
<p>Peptide H-SPNGTIQNIL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-ASQSVSSYLAWYQQK-OH
<p>Peptide H-ASQSVSSYLAWYQQK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-TFPDLESEF-OH
<p>Peptide H-TFPDLESEF-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-APRWDAPLRDPAL-OH
<p>Peptide H-APRWDAPLRDPAL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-TFDEIASGFR-OH
<p>Peptide H-TFDEIASGFR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-ALNEQIARL-OH
<p>Peptide H-ALNEQIARL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-MSSYAFFVQTCR-OH
<p>Peptide H-MSSYAFFVQTCR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Rotigotine
CAS:Formula:C19H25NOSPurity:>98.0%(T)(HPLC)Color and Shape:White to Almost white powder to crystalMolecular weight:315.48H-LTGISDPVTVK-OH
<p>Peptide H-LTGISDPVTVK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-SWMESEFRVY-OH
<p>Peptide H-SWMESEFRVY-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-DYKDHDGDYKDHDIDYKDDDDK-OH
<p>H-DYKDHDGDYKDHDIDYKDDDDK-OH is a custom research peptide; min purity 95%, TFA salt. For different specs please use the Peptide Quote Tool</p>RSV-B recombinant Nucleoprotein
<p>Please enquire for more information about RSV-B recombinant Nucleoprotein including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>H-GDSFTHTPPLDPQELDILK-OH
<p>Peptide H-GDSFTHTPPLDPQELDILK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-SLAPYAQDTQEK-OH
<p>Peptide H-SLAPYAQDTQEK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-RWPSCQKKF-OH
<p>Peptide H-RWPSCQKKF-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-TFTTQETITNAETAK-OH
<p>Peptide H-TFTTQETITNAETAK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-IPVALGLK-OH
<p>Peptide H-IPVALGLK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-KKQKVHALFYKLDIV-OH
<p>Peptide H-KKQKVHALFYKLDIV-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-GAGSLQPLALEGSLQKRG-OH
<p>Peptide H-GAGSLQPLALEGSLQKRG-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>BMF peptide
<p>The Bmf peptide is a short fragment derived from the protein Bmf (Bcl-2-modifying factor), which is a pro-apoptotic member of the BH3-only family of proteins. These proteins play crucial roles in regulating apoptosis by interacting with other members of the Bcl-2 family, such as Bax and Bak, to promote cell death.<br>The Bmf peptide specifically refers to a portion of the Bmf protein that contains the BH3 domain—a critical region responsible for its interaction with anti-apoptotic Bcl-2 proteins. This interaction inhibits the survival-promoting activity of Bcl-2 proteins, thereby triggering apoptosis.<br>In research and therapeutic contexts, peptides like Bmf are used to mimic the action of natural BH3-only proteins to help in BH3 profiling; Bmf promotes apoptosis in cancer cells or other diseased tissues by targeting the apoptotic pathways regulated by Bcl-2 family proteins. By doing so, they help in restoring the natural cell death process in cells that are evading apoptosis, such as in cancer.</p>H-DYKDDDDKDYKDDDDKDYKDDDDK-OH
<p>H-DYKDDDDKDYKDDDDKDYKDDDDK-OH is a custom research peptide; min purity 95%, TFA salt. For different specs please use the Peptide Quote Tool</p>H-QRSYVSGVL-OH
<p>Peptide H-QRSYVSGVL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-FNNFTVSFWLRVPKVSASHLE-OH
<p>Peptide H-FNNFTVSFWLRVPKVSASHLE-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>AF647 Maleimide
<p>A water-soluble, far-red-fluorescent dye that is spectrally similar to other 650 dyes that are used for flow cytometry, microscopy and other applications. An advantage of this wavelength is the the low auto-fluorescence of biological specimens in this region of the spectrum.Maleimide is the most popular sulfhydryl-reactive reactive group for conjugating the dye to a thiol group on a protein, oligonucleotide thiophosphate, or low molecular weight ligand.</p>Purity:Min. 95%H-HPL-NH2
<p>supplied as the TFA salt</p>Formula:C17H28N6O3Purity:Min. 95%Molecular weight:364.44 g/molH-LYEQLSGK-OH
<p>Peptide H-LYEQLSGK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-ALAAELNQLR-OH
<p>Peptide H-ALAAELNQLR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-GLFRALLRLLRSLWRLLLRA-NH2
<p>Peptide H-GLFRALLRLLRSLWRLLLRA-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-DESGLPQLTSYDAEVNAPIQGSRNLLQGEELLRALDQVN-OH
<p>Peptide H-DESGLPQLTSYDAEVNAPIQGSRNLLQGEELLRALDQVN-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-LYATVIHDI-OH
<p>H-LYATVIHDI-OH is a custom research peptide; min purity 95%, TFA salt. For different specs please use the Peptide Quote Tool</p>H-NSSNYCCELCCNPACTGCY-OH
CAS:<p>H-NSSNYCCELCCNPACTGCY-OH is a custom research peptide; min purity 95%, TFA salt. For different specs please use the Peptide Quote Tool</p>Formula:C79H112N22O30S6Molecular weight:2,042.28 g/molH-GPSVFPLAPSSK-OH
<p>Peptide H-GPSVFPLAPSSK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-GPEQTQGNFGDQELIR-OH
<p>Peptide H-GPEQTQGNFGDQELIR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-AVPIAQ-OH
<p>Peptide H-AVPIAQ-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-NIETIINTFHQYSVK-OH
<p>Peptide H-NIETIINTFHQYSVK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-DPTQQIPKL-OH
<p>Peptide H-DPTQQIPKL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-AMQMLKETINEEAAE-OH
<p>Peptide H-AMQMLKETINEEAAE-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-TLQTDSIDSFETQR-OH
<p>Peptide H-TLQTDSIDSFETQR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-PLSDLLLEML-OH
<p>Peptide H-PLSDLLLEML-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-GILFVGSGVSGGEEGAR-OH
<p>Peptide H-GILFVGSGVSGGEEGAR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-GESA-OH
<p>Peptide H-GESA-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-SESLKMIF-OH
<p>Peptide H-SESLKMIF-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-LTYCDL-OH
<p>Peptide H-LTYCDL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-KTCPVQLWV-OH
<p>Peptide H-KTCPVQLWV-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-SSRRR-OH
<p>Peptide H-SSRRR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-YGY-OH
<p>Peptide H-YGY-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-WKFDSRLAF-OH
<p>Peptide H-WKFDSRLAF-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-EQIIYGK-OH
<p>Peptide H-EQIIYGK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-KGK-OH
<p>Peptide H-KGK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-GPTGTGESKC-OH
<p>Peptide H-GPTGTGESKC-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-DRVYV-OH
<p>Peptide H-DRVYV-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-HPYFYAPELLFFAKR-OH
<p>Peptide H-HPYFYAPELLFFAKR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-YIIFVYIPL-OH
<p>Peptide H-YIIFVYIPL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-YPTFGEHKQEKDLEYC-OH
<p>Peptide H-YPTFGEHKQEKDLEYC-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-RTPDYFL-OH
<p>Peptide H-RTPDYFL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-FALSNAEDL-OH
<p>Peptide H-FALSNAEDL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-FVAPFPE-OH
<p>Peptide H-FVAPFPE-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-RLPADVLKK-OH
<p>Peptide H-RLPADVLKK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-EGDCNFVAPQGISSIIK-OH
<p>Peptide H-EGDCNFVAPQGISSIIK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-AVEEVSLR-OH
<p>Peptide H-AVEEVSLR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-AVPYPQR-OH
<p>Peptide H-AVPYPQR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-VNLLSAIK-OH
<p>Peptide H-VNLLSAIK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-EAEDLQVGQVELG-OH
<p>Peptide H-EAEDLQVGQVELG-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-Asp-pNA·HCl
CAS:<p>H-Asp-pNA·HCl is a versatile building block that can be used in the synthesis of complex compounds. It has been shown to be useful in the synthesis of reagents and speciality chemicals, as well as being a reaction component for the synthesis of pharmaceuticals. H-Asp-pNA·HCl is also a useful scaffold for the production of high quality and highly pure products.</p>Formula:C10H11N3O5·HClPurity:Min. 95%Color and Shape:SolidMolecular weight:289.67 g/molH-ALDAAYCFR-OH
<p>Peptide H-ALDAAYCFR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-QYSQPEQPI-OH
<p>Peptide H-QYSQPEQPI-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-VDCFLSRPTEKT-OH
<p>Peptide H-VDCFLSRPTEKT-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-VYKPSAGNNSLYR-OH
<p>Peptide H-VYKPSAGNNSLYR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-VNTLTER-OH
<p>Peptide H-VNTLTER-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-TAGIQIVADDLTVTNPAR-OH
<p>Peptide H-TAGIQIVADDLTVTNPAR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-LAEQAER-OH
<p>Peptide H-LAEQAER-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-GPSLFPLAPSSK-OH
<p>Peptide H-GPSLFPLAPSSK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-ALFDIESKV-OH
<p>Peptide H-ALFDIESKV-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-FLGGPPVCL-OH
<p>Peptide H-FLGGPPVCL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-RVPPRYHAKISPMVN-OH
<p>Peptide H-RVPPRYHAKISPMVN-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-DKISDVSTIVPYIGPALNIV-OH
<p>Peptide H-DKISDVSTIVPYIGPALNIV-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-YRSGIIAVV-OH
<p>Peptide H-YRSGIIAVV-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-TISSEDEPFNLR-OH
<p>Peptide H-TISSEDEPFNLR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-RDHMVLHEYVNAAGIT-OH
<p>Peptide H-RDHMVLHEYVNAAGIT-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-KLWESPQEI-OH
<p>Peptide H-KLWESPQEI-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-KEELDKYFKNHTSPDVDLG-OH
<p>Peptide H-KEELDKYFKNHTSPDVDLG-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-GAQASPPPIAPYPSPTR-OH
<p>Peptide H-GAQASPPPIAPYPSPTR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-RF-OH
<p>Peptide H-RF-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-SLLKFLAKV-OH
<p>Peptide H-SLLKFLAKV-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-LPSTSGSEGVPFR-OH
<p>Peptide H-LPSTSGSEGVPFR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-IVSFSFQNM-OH
<p>Peptide H-IVSFSFQNM-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-GAGAGAGAGAGAGAGA-OH
<p>Peptide H-GAGAGAGAGAGAGAGA-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-HTQGYFPDWQ-OH
<p>Peptide H-HTQGYFPDWQ-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-CASDAKAYDTEVHNV-OH
<p>H-CASDAKAYDTEVHNV-OH is a custom research peptide; min purity 95%, TFA salt. For different specs please use the Peptide Quote Tool</p>H-MPRFMDYWEGLN-OH
<p>Peptide H-MPRFMDYWEGLN-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-LDLSNVQSK-OH
<p>Peptide H-LDLSNVQSK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-LTVEDPVTVEYITR-OH
<p>Peptide H-LTVEDPVTVEYITR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-DSHEKRHHGYRRKFHEKHHSHREFPFYGDYGSNYLYDN-OH
<p>Peptide H-DSHEKRHHGYRRKFHEKHHSHREFPFYGDYGSNYLYDN-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-TSTSPIVK-OH
<p>Peptide H-TSTSPIVK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>IBVE
CAS:<p>Please enquire for more information about IBVE including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Purity:Min. 95%H-RIVQRIKDFL-OH
<p>Peptide H-RIVQRIKDFL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-VTGEVLDILTR-OH
<p>Peptide H-VTGEVLDILTR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-YTIAALLSPYSYSTTAVVTNPKE-OH
<p>Peptide H-YTIAALLSPYSYSTTAVVTNPKE-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-PVNFKFLSH-OH
<p>Peptide H-PVNFKFLSH-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-GSKKPVPIIYCNRRTGKCQRM-OH
<p>Peptide H-GSKKPVPIIYCNRRTGKCQRM-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-IPLENLQIIR-OH
<p>Peptide H-IPLENLQIIR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>W-K-Y-M-V-M-NH2
<p>Peptide W-K-Y-M-V-M-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Formula:C41H61N9O7S2Molecular weight:856.13 g/molH-YEALLLGGLPQEGLAR-OH
<p>Peptide H-YEALLLGGLPQEGLAR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-ILMWEAVTL-OH
<p>Peptide H-ILMWEAVTL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-GPFPIIV-OH
<p>Peptide H-GPFPIIV-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-NLHQPPLR-OH
<p>Peptide H-NLHQPPLR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Uridine
CAS:Formula:C9H12N2O6Purity:>98.0%(T)(HPLC)Color and Shape:White powder to crystalMolecular weight:244.20H-REEMEVHEL-OH
<p>Peptide H-REEMEVHEL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-CCCC-OH
<p>Peptide H-CCCC-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Formula:C12H22N4O5S4Molecular weight:430.59 g/molH-VQDSAPVETPR-OH
<p>Peptide H-VQDSAPVETPR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-FYY-OH
<p>Peptide H-FYY-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-SSVWNATTAI-OH
<p>Peptide H-SSVWNATTAI-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-AAAASAISVARTLLVFE-OH
<p>Peptide H-AAAASAISVARTLLVFE-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-PGLYYF-OH
<p>Peptide H-PGLYYF-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-CEHF-OH
<p>Peptide H-CEHF-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-YLQVNSLQTV-OH
<p>Peptide H-YLQVNSLQTV-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-CSCSSLMDKECVYFCHLDIIWVNTPEHVVPYGLGSPRS-OH
<p>H-CSCSSLMDKECVYFCHLDIIWVNTPEHVVPYGLGSPRS-OH is a custom research peptide; min purity 95%, TFA salt. For different specs please use the Peptide Quote Tool</p>H-TFEYVSQPFLMDLE-OH
<p>Peptide H-TFEYVSQPFLMDLE-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-TGESAEFVCK-OH
<p>Peptide H-TGESAEFVCK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Monoammonium Glycyrrhizinate
CAS:Formula:C42H65NO16Purity:>75.0%(HPLC)Color and Shape:White to Light yellow powder to crystalMolecular weight:839.97H-FLPSDFFPSV-OH
<p>Peptide H-FLPSDFFPSV-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-VVSVLTVLHQDWLDGK-OH
<p>Peptide H-VVSVLTVLHQDWLDGK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Polyethylene Glycol Bis(3-aminopropyl) Ether
CAS:Color and Shape:White to Light yellow to Dark green powder to lumpH-HLWYLLDLK-OH
<p>Peptide H-HLWYLLDLK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-INDISHTQSVSSK-OH
<p>Peptide H-INDISHTQSVSSK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-QKTLYSFF-OH
<p>Peptide H-QKTLYSFF-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-NNLEALEDFEK-OH
<p>Peptide H-NNLEALEDFEK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-ASSILAT-OH
<p>Peptide H-ASSILAT-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-APGP-OH
<p>Peptide H-APGP-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-DYVDRFYKTLRAEQA-OH
<p>Peptide H-DYVDRFYKTLRAEQA-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-DISEMFLQIYK-OH
<p>Peptide H-DISEMFLQIYK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-RLMAPVGSV-OH
<p>Peptide H-RLMAPVGSV-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-RKIYDLIEL-OH
<p>Peptide H-RKIYDLIEL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-LQQCPF-OH
<p>Peptide H-LQQCPF-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-CVTREEAKVFVEDDSTHA-OH
<p>Peptide H-CVTREEAKVFVEDDSTHA-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-RGDSPASSKP-OH
<p>Peptide H-RGDSPASSKP-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Formula:C40H68N14O16Molecular weight:1,001.1 g/molH-DPIYALSWSGMA-OH
<p>Peptide H-DPIYALSWSGMA-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-RSNYVLKG-OH
<p>Peptide H-RSNYVLKG-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-WFYIASAFR-OH
<p>Peptide H-WFYIASAFR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-RFF-OH
<p>Peptide H-RFF-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-VLHPLEGAVVIIFK-OH
<p>Peptide H-VLHPLEGAVVIIFK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Pyritinol
CAS:Formula:C16H20N2O4S2Purity:>96.0%(T)(HPLC)Color and Shape:White to Light yellow to Light orange powder to crystalMolecular weight:368.47H-AEVIWTSSDHQVLSGK-OH
<p>Peptide H-AEVIWTSSDHQVLSGK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-CGRGDSPK-OH
<p>Peptide H-CGRGDSPK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-EEQFNSTYR-OH
<p>Peptide H-EEQFNSTYR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-AITIFQER-OH
<p>Peptide H-AITIFQER-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-ARVYIHPF-OH
<p>Peptide H-ARVYIHPF-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-SGGGDLTLGLEPSEEEAPR-OH
<p>Peptide H-SGGGDLTLGLEPSEEEAPR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>N-(4-Fluorophenyl)glycine
CAS:Formula:C8H8FNO2Purity:>98.0%(GC)(T)Color and Shape:White to Light yellow powder to crystalMolecular weight:169.16Suc-Ala-Ala-Pro-Phe-pNA
CAS:<p>N-Succinyl-L-alanyl-L-alanyl-L-prolyl-L-phenylalanine 4-nitroanilide is a colorimetric substrate for peptidyl-prolyl isomerase, chymotrypsin and human leukocyte cathepsin G but not reactive with elastase.</p>Formula:C30H36N6O9Purity:Min. 95%Color and Shape:PowderMolecular weight:624.64 g/molH-HTPINLVR-OH
<p>Peptide H-HTPINLVR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>L-Phenylalanyl-L-phenylalanine
CAS:Formula:C18H20N2O3Purity:>98.0%(T)(HPLC)Color and Shape:White to Light yellow powder to crystalMolecular weight:312.37H-DPAPRRGEPHVTRRTPDYFL-OH
<p>Peptide H-DPAPRRGEPHVTRRTPDYFL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-HCIRNKSVI-OH
<p>Peptide H-HCIRNKSVI-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-RRKWQKTGHAVRAIGRL-OH
<p>Peptide H-RRKWQKTGHAVRAIGRL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-YSPTSPSYSPTSPSYSPTSPS-OH
<p>Peptide H-YSPTSPSYSPTSPSYSPTSPS-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-PRCGNPDVA-OH
<p>Peptide H-PRCGNPDVA-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-AAEGLDTQR-OH
<p>Peptide H-AAEGLDTQR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-VGDTLNLNLR-OH
<p>Peptide H-VGDTLNLNLR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-AEMWYSEVEEARRR-OH
<p>Peptide H-AEMWYSEVEEARRR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>L-(+)-Fructose
CAS:Formula:C6H12O6Purity:>95.0%(HPLC)Color and Shape:White to Almost white powder to crystalMolecular weight:180.16H-MTSAIGILPV-OH
<p>Peptide H-MTSAIGILPV-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-IPSYKKLIM-OH
<p>Peptide H-IPSYKKLIM-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-PSQGKGRGLSLSRFSWGALTLGEFLKL-OH
<p>Peptide H-PSQGKGRGLSLSRFSWGALTLGEFLKL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-VTWFHAIHVSGTNGT-OH
<p>Peptide H-VTWFHAIHVSGTNGT-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-EDHLFR-OH
<p>Peptide H-EDHLFR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-VYSTSVTGSR-OH
<p>Peptide H-VYSTSVTGSR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-NSSKVSQNY-OH
<p>Peptide H-NSSKVSQNY-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-NGN-OH
<p>Peptide H-NGN-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>N-(tert-Butoxycarbonyl)-L-serine β-Lactone
CAS:Formula:C8H13NO4Purity:>98.0%(N)Color and Shape:White to Almost white powder to crystalMolecular weight:187.20H-NSTGSLTTR-OH
<p>Peptide H-NSTGSLTTR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-PRPRPR-OH
<p>Peptide H-PRPRPR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-QKWDATATELNNALQ-OH
<p>Peptide H-QKWDATATELNNALQ-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Vasopressin acetate
CAS:Controlled Product<p>Vasopressin acetate is a synthetic analog of the natural hormone vasopressin, which is derived from peptide synthesis. This product acts as an antidiuretic hormone, primarily targeting kidney receptors to promote water reabsorption and constrict blood vessels. Its mode of action involves binding to V1 and V2 receptors, leading to increased water retention and vasoconstriction.</p>Formula:C46H65N15O12S2•(C2H4O2)xPurity:Min. 98 Area-%Color and Shape:White PowderMolecular weight:1198.26H-SGATGVAIK-OH
<p>Peptide H-SGATGVAIK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-EKYNLTSVL-OH
<p>Peptide H-EKYNLTSVL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-VLQPPSILYGGR-OH
<p>Peptide H-VLQPPSILYGGR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-GGVGKIIEYFIGGGVGRYG-OH
<p>Peptide H-GGVGKIIEYFIGGGVGRYG-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-LRKLRKRLLRLVGRQLEEFL-OH
<p>Peptide H-LRKLRKRLLRLVGRQLEEFL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-PQPEQPFPQ-OH
<p>Peptide H-PQPEQPFPQ-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-LLIYYTSR-OH
<p>Peptide H-LLIYYTSR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-YPWTRRF-OH
<p>Peptide H-YPWTRRF-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-LKKILAYFLPEDAILK-OH
<p>Peptide H-LKKILAYFLPEDAILK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-STALQLIQR-OH
<p>Peptide H-STALQLIQR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-GFFYTPK-OH
<p>Peptide H-GFFYTPK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-ILSPFLPLL-OH
<p>Peptide H-ILSPFLPLL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-MLLSKINSL-OH
<p>Peptide H-MLLSKINSL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-NPANPVQ-OH
<p>Peptide H-NPANPVQ-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

