Biochemicals and Reagents

<p>Affinity purified Rabbit polyclonal TNFAP1 antibody</p>

<p>The Fenitrothion antibody is a powerful tool used in research and diagnostics. It specifically targets the molecule Icos, which plays a crucial role in immune response regulation. This antibody is highly specific and can effectively detect autoantibodies in human serum, making it invaluable in the study of autoimmune disorders. Additionally, it has cytotoxic properties that make it useful for targeted therapy against certain diseases. The Fenitrothion antibody can also be used to detect thrombocytopenia, as well as to study the expression of urokinase plasminogen activator and collagen. Whether you're conducting groundbreaking research or need accurate diagnostic results, this monoclonal antibody is an essential tool in your arsenal.</p>

<p>Rabbit polyclonal AKAP14 antibody</p>

HSPA6 antibody was raised using a synthetic peptide corresponding to a region with amino acids EYEHQKRELEQICRPIFSRLYGGPGVPGGSSCGTQARQGDPSTGPIIEEV

Cardiotrophin 1 antibody was raised in rabbit using highly purerecombinant hCT-1 (human Cardiotrophin-1) as the immunogen.

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of GFPT2 antibody, catalog no. 70R-8530</p>

<p>E2F8 antibody was raised in Rabbit using Human E2F8 as the immunogen</p>

A synthetic peptide for use as a blocking control in assays to test for specificity of GAS8 antibody, catalog no. 70R-3968

<p>Rabbit polyclonal NUF2 antibody</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of MAP3K14 antibody, catalog no. 70R-3485</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of RAP1GDS1 antibody, catalog no. 70R-9838</p>

Rabbit anti-human IgG (Rhodamine) was raised in rabbit using human IgG F(ab')2 fragment as the immunogen.

<p>Hantavirus antibody was raised in mouse using recombinant puumala nucleocaspid protein as the immunogen.</p>

<p>The CXCR2 antibody is a highly effective tool used in the field of life sciences. It is a glycoprotein that specifically targets and binds to the CXCR2 receptor, which plays a crucial role in various cellular processes such as endothelial growth and chemokine signaling. This antibody is widely used in research settings to study the function of CXCR2 and its involvement in different biological pathways.</p>

<p>Affinity purified Rabbit polyclonal FBXL12 antibody</p>

The RhoH antibody is a polyclonal antibody that is specifically designed to target and bind to RhoH, a protein involved in various cellular processes. This antibody has been extensively tested and validated for its specificity and sensitivity in detecting RhoH in different samples.

<p>The ApoD antibody is a monoclonal antibody that specifically targets tumor necrosis factor-alpha (TNF-α). It is produced by hybridoma cells and has been widely used in the field of Life Sciences for research purposes. This monoclonal antibody has shown to effectively neutralize TNF-α, which plays a crucial role in inflammation and immune response. In addition to TNF-α, the ApoD antibody also targets other cytokines such as interleukin-6 (IL-6) and leukemia inhibitory factor (LIF). The binding of this antibody to its target molecules can modulate various cellular processes including transmembrane conductance, epidermal growth factor signaling, and oncogenic kinase activity. With its high specificity and affinity, the ApoD antibody is a valuable tool for researchers studying these pathways and exploring potential therapeutic applications. Additionally, polyclonal antibodies against ApoD are also available for researchers who require a broader range of epitope recognition.</p>

C1orf96 antibody was raised using the middle region of C1orf96 corresponding to a region with amino acids ENKHPFALYGWGEKQTDTGSQKTHNVCASAPVHEIHESALRAKNRRQVEK

<p>Rabbit polyclonal EXTL3 antibody (HRP)</p>

<p>Rabbit polyclonal MPZ antibody</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of KCTD11 antibody, catalog no. 70R-1491</p>

<p>Purified recombinant Human MYL12B Protein (His tag)</p>

<p>TCEAL8 antibody was raised in rabbit using the middle region of TCEAL8 as the immunogen</p>

Rabbit polyclonal NFKB p105 antibody

This antibody reacts with heavy chains on human IgG (gamma chain).

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of KCNH6 antibody, catalog no. 70R-5116</p>

Atp5d antibody was raised in rabbit using the C terminal of Atp5d as the immunogen

ARL15 antibody was raised in Rabbit using Human ARL15 as the immunogen

<p>PSMA5 antibody was raised using a synthetic peptide corresponding to a region with amino acids FGGVDEKGPQLFHMDPSGTFVQCDARAIGSASEGAQSSLQEVYHKSMTLK</p>

<p>ACAD8 antibody was raised in Rabbit using Human ACAD8 as the immunogen</p>

<p>Rabbit polyclonal Glucokinase Regulator antibody</p>

<p>Recombinant Human NT5C3B protein</p>

<p>RAD51L3 antibody was raised in rabbit using the C terminal of RAD51L3 as the immunogen</p>

<p>CD48 antibody was raised in Rabbit using Human CD48 as the immunogen</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of ATPAF1 antibody, catalog no. 70R-9517</p>

<p>Purified Polyclonal CABP5 antibody</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of KCND2 antibody, catalog no. 70R-5109</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of ZNF259 antibody, catalog no. 70R-8255</p>

<p>DNM1 antibody was raised in Rabbit using Human DNM1 as the immunogen</p>

Resistin antibody (biotin) was raised in goat using highly pure recombinant murine resistin as the immunogen.

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of ASF1A antibody, catalog no. 70R-9597</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of ACAT2 antibody, catalog no. 70R-1083</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of LOC339977 antibody, catalog no. 70R-6659</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of FN1 antibody, catalog no. 70R-6082</p>

<p>Synaptojanin 1 antibody was raised using the middle region of SYNJ1 corresponding to a region with amino acids PGVARREMEAPKSPGTTRKDNIGRSQPSPQAGLAGPGPAGYSTARPTIPP</p>

RBMS3 antibody was raised using the middle region of RBMS3 corresponding to a region with amino acids PTAVSIEGVVADTSPQTVAPSSQDTSGQQQQIAVDTSNEHAPAYSYQQSK

<p>NDUFA9 antibody was raised in Rabbit using Human NDUFA9 as the immunogen</p>

GSTM5 antibody was raised in Rabbit using Human GSTM5 as the immunogen

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of LMF2 antibody, catalog no. 70R-6271</p>

<p>Affinity purified Rabbit polyclonal C1orf165 antibody</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of ADH1B antibody, catalog no. 70R-3920</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of ALKBH8 antibody, catalog no. 70R-5009</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of NT5C1B antibody, catalog no. 70R-4405</p>

<p>EEFSEC antibody was raised in Rabbit using Human EEFSEC as the immunogen</p>

<p>The STAT3 antibody is a powerful tool used in Life Sciences research. It is designed to specifically target and bind to the STAT3 protein, which plays a crucial role in cell signaling and gene expression. This antibody can be used for various applications, including Western blotting, immunohistochemistry, and immunofluorescence.</p>

<p>The SERPINB13 antibody is a highly effective anti-HER2 monoclonal antibody. It belongs to the class of monoclonal antibodies and specifically targets HER2, a protein that is overexpressed in certain types of cancer cells. By binding to HER2, this antibody inhibits its activity and prevents the growth and spread of cancer cells.</p>

Rabbit polyclonal NUDT6 antibody

<p>KCNIP3 antibody was raised in Rabbit using Human KCNIP3 as the immunogen</p>

<p>Rabbit polyclonal PIGO antibody</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of SNTB1 antibody, catalog no. 70R-6691</p>

Influenza A antibody (H3N2) (biotin) was raised in goat using influenza A, strain Texas 1/77 (H3N2) as the immunogen.

<p>DRD2 antibody was raised in Rabbit using Human DRD2 as the immunogen</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of GRIP1 antibody, catalog no. 70R-7931</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of PARN antibody, catalog no. 20R-1155</p>

The ALDH2 antibody is a monoclonal antibody used in Life Sciences research. It has been shown to effectively neutralize ALDH2 activity, which is essential for the metabolism of ethanol and other aldehydes. This antibody can be used in various applications such as lysis and electrode-based assays to study the role of ALDH2 in different biological processes.

DDT antibody was raised in Rabbit using Human DDT as the immunogen

Purified recombinant E.coli NDK protein (His tag)

<p>IKBKG antibody was raised in Rabbit using Human IKBKG as the immunogen</p>

<p>ERCC1 antibody was raised in Rabbit using Human ERCC1 as the immunogen</p>

<p>Purified Polyclonal CEBP beta antibody</p>

<p>Rabbit polyclonal ANKRD20A3 antibody</p>

<p>IL8RB antibody was raised in Rabbit using Human IL8RB as the immunogen</p>

<p>Cytochrome b245 Light Chain Monoclonal Antibody</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of CANT1 antibody, catalog no. 70R-5814</p>

<p>FBXO2 antibody was raised in Rabbit using Human FBXO2 as the immunogen</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of ELAVL4 antibody, catalog no. 70R-4836</p>

<p>Keratin K76 antibody was raised in Guinea Pig using synthetic peptide (C-LGGAGSISVSHSGM) of human keratin coupled to KLH as the immunogen.</p>

<p>COX4I2 antibody was raised in Rabbit using Human COX4I2 as the immunogen</p>

Rabbit polyclonal TIMP2 antibody (FITC)

<p>The ALDH1A2 antibody is a highly specialized product in the field of Life Sciences and Antibodies. It is specifically designed to target and interact with ALDH1A2, a growth factor that plays a crucial role in various biological processes. This antibody has been extensively tested and validated for its effectiveness in detecting and quantifying ALDH1A2 levels.</p>

<p>CDKL3 antibody was raised in Rabbit using Human CDKL3 as the immunogen</p>

<p>Rabbit polyclonal Catenin gamma antibody</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of CD22 antibody, catalog no. 70R-9913</p>

A synthetic peptide for use as a blocking control in assays to test for specificity of BTNL9 antibody, catalog no. 70R-7019

Endogl1 antibody was raised in rabbit using the N terminal of Endogl1 as the immunogen

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of ACSS2 antibody, catalog no. 70R-10248</p>

Rabbit polyclonal ABHD14A antibody

Rabbit polyclonal OVOL1 antibody

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of ACMSD antibody, catalog no. 70R-6311</p>

<p>EXOC6 antibody was raised using the middle region of EXOC6 corresponding to a region with amino acids YRCLHIYSVLGDEETFENYYRKQRKKQARLVLQPQSNMHETVDGYRRYFT</p>

<p>Region of CNTF protein corresponding to amino acids MAFTEHSPLT PHRRDLCSRS IWLARKLRSD LTALTESYVK HQGLNKNINL DSADGMPVAS TDQWSELTEA ERLQENLQAY RTFHVLLARL LEDQQVHFTP TEGDFHQAIH TLLLQVAAFA YQIEELMILL EYKIPRNEAD GMPINVGDGG LFEKKLWGLK VLQELSQWTV RSIHDLRFIS SHQTGIPARG SHYIANNKKM.</p>

<p>Purified recombinant Human STX2 Protein (His tag)</p>

<p>Rabbit Polyclonal Androgen Receptor antibody (Ser650)</p>

<p>COCH antibody was raised in Rabbit using Human COCH as the immunogen</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of SIGLEC12 antibody, catalog no. 70R-6150</p>

<p>Affinity purified Rabbit polyclonal HIF2 alpha antibody</p>

<p>FSCN1 antibody was raised in Rabbit using Human FSCN1 as the immunogen</p>

<p>LOXL4 antibody was raised in rabbit using the middle region of LOXL4 as the immunogen</p>

GPR35 antibody was raised in Rabbit using Human GPR35 as the immunogen

<p>The SPARC antibody is a highly specialized nuclear antibody that is widely used in the field of Life Sciences. It specifically targets collagen and serves as an electrode for various research applications. Additionally, this antibody has neutralizing properties and can effectively bind to alpha-fetoprotein, making it a valuable tool in cancer research. The SPARC antibody is a monoclonal antibody that also exhibits anti-mesothelin activity and can be used as an antiviral agent. It is commonly employed in the development of inhibitors and therapeutic antibodies. This product is available in both polyclonal and monoclonal forms, providing researchers with options to suit their specific needs. The SPARC antibody is activated upon interaction with human serum, allowing for precise detection and analysis of growth factors.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of GRIP1 antibody, catalog no. 20R-1077</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of HNF1A antibody, catalog no. 70R-9085</p>

<p>Affinity purified Rabbit polyclonal HSP70s antibody</p>

<p>PRTN3 antibody was raised in rabbit using the N terminal of PRTN3 as the immunogen</p>

GFAP antibody was raised in rabbit using the C terminus of the 50 kDa human protein as the immunogen.

NGEF antibody was raised in Rabbit using Human NGEF as the immunogen

<p>Rabbit polyclonal SmG antibody (biotin)</p>

The AMH antibody is a highly potent and cytotoxic human protein that acts as a growth factor. It is capable of causing lysis and immobilization of target cells, making it an effective tool for research and diagnostic purposes. This antibody has been extensively studied for its neutralizing properties against insulin and insulin antibodies, making it a valuable asset in the field of diabetes research. Additionally, it has shown promising results in the detection and quantification of autoantibodies associated with various diseases. The AMH antibody also plays a crucial role in Life Sciences, particularly in the study of fibronectin, collagen, β-catenin, and other important cellular components. With both polyclonal and monoclonal variants available, this antibody offers versatility and reliability in scientific investigations.

18-247 amino acids: MGSSHHHHHH SSGLVPRGSH MEDDVTTTEE LAPALVPPPK GTCAGWMAGI PGHPGHNGTP GRDGRDGTPG EKGEKGDAGL LGPKGETGDV GMTGAEGPRG FPGTPGRKGE PGEAAYVYRS AFSVGLETRV TVPNVPIRFT KIFYNQQNHY DGSTGKFYCN IPGLYYFSYH ITVYMKDVKV SLFKKDKAVL FTYDQYQEKN VDQASGSVLL HLEVGDQVWL QVYGDGDHNG LYADNVNDST FTGFLLYHDT N

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of ASGR2 antibody, catalog no. 70R-2075</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of SRGAP1 antibody, catalog no. 70R-9502</p>

<p>CCDC146 antibody was raised using the middle region of CCDC146 corresponding to a region with amino acids KEIEKEWLKVLRDEEMHALAIAEKSQEFLEADNRQLPNGVYTTAEQRPNA</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of Nxph1 antibody, catalog no. 70R-9330</p>

Rabbit Polyclonal HSF1 antibody (Ser303)

<p>AKR1C3 antibody was raised in Rabbit using Human AKR1C3 as the immunogen</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of HLTF antibody, catalog no. 70R-8247</p>

The p53 antibody is a highly specialized monoclonal antibody used in Life Sciences research. It plays a crucial role in the regulation of pluripotent cells and is activated in response to various cellular stresses. This inhibitory factor targets oncogenic kinases and promotes cell cycle arrest or apoptosis, depending on the severity of DNA damage. The p53 antibody is widely used for immunohistochemical detection and chromatin immunoprecipitation assays to study its binding activity and interactions with other proteins. Additionally, it has been found to have potential diagnostic value, as autoantibodies against p53 have been detected in certain cancers. Researchers rely on this powerful tool to investigate the intricate mechanisms involved in cellular responses and gain insights into cancer biology.

Rabbit polyclonal MRPL16 antibody

<p>The Pleiotrophin antibody is a highly versatile and reactive chemokine that plays a crucial role in various biological processes. This antibody is available as both polyclonal and monoclonal forms, offering researchers flexibility in their experimental designs. It has been extensively studied in the field of Life Sciences due to its ability to neutralize the effects of Pleiotrophin, thereby modulating cellular functions.</p>

<p>Gliadin Antibody is a specific antibody that is used in various applications, particularly in the field of Life Sciences. It is commonly used for the detection and quantification of gliadin, a protein found in wheat and other gluten-containing grains. This antibody can be used in techniques such as hemolysis assays, reaction solutions, polymerase chain reactions (PCR), dodecyl sulfate-polyacrylamide gel electrophoresis (SDS-PAGE), and more. The Gliadin Antibody is highly specific and recognizes gliadin with high affinity. It can be used to study the presence and distribution of gliadin in different samples, such as food products or biological samples. This antibody is often used in research related to celiac disease, gluten sensitivity, and other gluten-related disorders. Monoclonal antibodies are widely used in research and diagnostics due to their high specificity and reproducibility. The Gliadin Antibody is a monoclonal antibody, meaning it is</p>

EPHA2 antibody was raised in Mouse using a purified recombinant fragment of EPHA2 expressed in E. coli as the immunogen.

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of PFKL antibody, catalog no. 70R-1248</p>

<p>The Desmin antibody is an important tool in the field of Life Sciences. It is a monoclonal antibody that specifically targets Desmin, a protein involved in muscle cell structure and function. This antibody has been widely used in research to study the role of Desmin in various biological processes.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of RELB antibody, catalog no. 20R-1183</p>

CORIN antibody was raised using the C terminal of CORIN corresponding to a region with amino acids HPRYSRAVVDYDISIVELSEDISETGYVRPVCLPNPEQWLEPDTYCYITG

<p>Goat anti-cat IgG (biotin) was raised in goat using feline IgG F(c) fragment as the immunogen.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of LPCAT1 antibody, catalog no. 70R-6633</p>

RPRD1B antibody was raised using the middle region of RPRD1B corresponding to a region with amino acids KKSLKRTFQQIQEEEDDDYPGSYSPQDPSAGPLLTEELIKALQDLENAAS

Rabbit anti-cat IgG (H + L) (Alk Phos) was raised in rabbit using feline IgG whole molecule as the immunogen.

ESAM antibody was raised in Rabbit using Human ESAM as the immunogen

A synthetic peptide for use as a blocking control in assays to test for specificity of PTPRR antibody, catalog no. 70R-6617

<p>Rabbit polyclonal ARMC6 antibody</p>

<p>Affinity purified Rabbit polyclonal MRCK alpha antibody</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of PIGZ antibody, catalog no. 70R-7100</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of SFXN1 antibody, catalog no. 70R-6522</p>

<p>Rabbit IgG (H + L) purified protein</p>

<p>Rabbit polyclonal PA2G4 antibody</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of SSB antibody, catalog no. 70R-1427</p>

<p>CD5 antibody (FITC) was raised in mouse using feline CD5 as the immunogen.</p>

<p>ABHD5 antibody was raised using the C terminal of ABHD5 corresponding to a region with amino acids SVIFGARSCIDGNSGTSIQSLRPHSYVKTIAILGAGHYVYADQPEEFNQK</p>

<p>SF3A1 antibody was raised using the N terminal of SF3A1 corresponding to a region with amino acids RQNEINNPKFNFLNPNDPYHAYYRHKVSEFKEGKAQEPSAAIPKVMQQQQ</p>

This antibody reacts with heavy chains on llama IgG and light chains on all llama immunoglobulins.

<p>The Phosphotyrosine antibody is a highly specialized monoclonal antibody used in Life Sciences research. It is designed to specifically recognize and bind to phosphorylated tyrosine residues on proteins, making it an essential tool for studying kinase substrates and phosphatase activity. This antibody is particularly useful in investigating signaling pathways involving tyrosine kinase receptors, such as the epidermal growth factor receptor or colony-stimulating factor receptor.</p>

KCNH6 antibody was raised using a synthetic peptide corresponding to a region with amino acids PRMPHLAVATDKTLAPSSEQEQPEGLWPPLASPLHPLEVQGLICGPCFSS

<p>Rabbit polyclonal ZNF24 antibody</p>

The Fentanyl Antibody is a highly specialized product used in Life Sciences research. It is designed to detect and quantify fentanyl, a potent synthetic opioid, in various samples. The antibody is immobilized on magnetic particles, allowing for easy separation and purification of fentanyl from complex matrices. This product is commonly used in immunoassays, where it can be utilized for the development of diagnostic tests or screening assays.

Rabbit polyclonal IL1RA antibody (FITC)

<p>Pigeon Serum Albumin is a versatile protein that has various applications in the field of Life Sciences. It is known for its proteolytic activity and its ability to promote hepatocyte growth. Pigeon Serum Albumin can be used in electrophoresis studies to separate and analyze proteins based on their charge and size. Additionally, it has been used as an antigen in DNA vaccine development and in the culture of pluripotent stem cells.</p>

<p>NDUFA6 antibody was raised in Rabbit using Human NDUFA6 as the immunogen</p>

<p>CREB3 antibody was raised in Rabbit using Human CREB3 as the immunogen</p>

<p>Histamine-OVA is a monoclonal antibody that belongs to the field of Life Sciences. It acts as a growth factor and has neutralizing properties. This antibody has been extensively studied in various experiments, including its interaction with liver microsomes and ovalbumin. It has also been shown to modulate the production of interferon and other cytokines. Histamine-OVA is known for its ability to bind to specific receptors, such as cation channels and retinoid receptors, leading to downstream signaling events. Additionally, this antibody can be conjugated with haptens or streptavidin for various applications in research and diagnostics. Overall, Histamine-OVA is a versatile tool in the field of Life Sciences with potential applications in immunology, cell biology, and molecular biology research.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of POLR3GL antibody, catalog no. 70R-10078</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of SERAC1 antibody, catalog no. 70R-10152</p>

The Transglutaminase 2 antibody is a highly specialized monoclonal antibody used in Life Sciences research. It specifically targets and binds to transglutaminase 2, an enzyme that plays a crucial role in various biological processes. This antibody has been extensively tested and proven to be reactive against transglutaminase 2 in a variety of bioassays.

<p>NHLRC1 antibody was raised in Rabbit using Human NHLRC1 as the immunogen</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of Gabarapl2 antibody, catalog no. 70R-9176</p>

<p>Dopamine transporter antibody was raised in rabbit using an 18 amino acid peptide of rat DAT conjugated to KLH. as the immunogen.</p>

This antibody reacts with heavy chains on human IgM (mu chain).

OPA3 antibody was raised in rabbit using the C terminal of OPA3 as the immunogen

Keratin K8 antibody was raised in Mouse using a purified recombinant fragment of human Cytokeratin (aa391-483) expressed in E. coli as the immunogen.

The CHAT antibody is a polyclonal antibody that specifically targets the choline acetyltransferase (CHAT) enzyme. CHAT is responsible for the synthesis of acetylcholine, a neurotransmitter involved in cholinergic signaling. This antibody is widely used in life sciences research to study the role of cholinergic signaling in various biological processes.

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of NUDCD3 antibody, catalog no. 70R-3285</p>

MGEA5 antibody was raised in Rabbit using Human MGEA5 as the immunogen

<p>KHDRBS2 antibody was raised using the middle region of KHDRBS2 corresponding to a region with amino acids EAYSRMSHALEEIKKFLVPDYNDEIRQEQLRELSYLNGSEDSGRGRGIRG</p>

A synthetic peptide for use as a blocking control in assays to test for specificity of IGF1R antibody, catalog no. 70R-10422

Region of IGF BP4 protein corresponding to amino acids DEAIHCPPCS EEKLARCRPP VGCEELVREP GCGCCATCAL GLGMPCGVYT PRCGSGLRCY PPRGVEKPLH TLMHGQGVCM ELAEIEAIQE SLQPSDKDEG DHPNNSFSPC SAHDRRCLQK HFAKIRDRST SGGKMKVNGA PREDARPVPQ GSCQSELHRA LERLAASQSR THEDLYIIPI PNCDRNGNFH PKQCHPALDG QRGKCWCVDR KTGVKLPGGL EPKGELDCHQ LADSFRE.

Astrovirus antibody was raised in mouse using group antigen of astrovirus as the immunogen.

<p>C10ORF56 antibody was raised using the middle region of C10Orf56 corresponding to a region with amino acids LTEHFSDLTLTSEARKPSKRPPPNYLCHLCFNKGHYIKDCPQARPKGEGL</p>

<p>Rabbit polyclonal PRKCSH antibody</p>

EXOSC3 antibody was raised using the middle region of EXOSC3 corresponding to a region with amino acids TKCGRLRHKEPGSGSGGGVYWVDSQQKRYVPVKGDHVIGIVTAKSGDIFK

Purified Rabbit polyclonal M3K-E14 antibody

<p>gamma Synuclein antibody was raised in Rabbit using recombinant human gamma-Synuclein (1-127aa) as the immunogen.</p>

<p>MRPL27 antibody was raised in Rabbit using Human MRPL27 as the immunogen</p>

<p>The Keratin 18 antibody is a highly specialized product used in the field of Life Sciences. This antibody is designed to specifically bind to Keratin 18, a protein found in various tissues and cells. It acts as a neutralizing agent by blocking receptor binding sites on Keratin 18, preventing unwanted interactions and downstream effects.</p>

<p>The ADAMTS4 antibody is a highly specialized protein that has cytotoxic properties and promotes the growth of keratinocytes and endothelial cells. It is commonly used in research and medical applications to study the function of ADAMTS4, a protein involved in various cellular processes. This antibody specifically targets the circumsporozoite protein, which is expressed on the surface of certain cells. Additionally, it has been shown to have neutralizing effects on other proteins such as anti-CD33 antibody, growth factors, and family kinase inhibitors. The ADAMTS4 antibody is a valuable tool for scientists and researchers working in fields such as immunology, oncology, and cell biology.</p>

Rabbit anti-rat IgG (H+L) was raised in rabbit using rat IgG whole molecule as the immunogen.

<p>EIF2S1 antibody was raised in Rabbit using Human EIF2S1 as the immunogen</p>

RWDD4A antibody was raised using the middle region of RWDD4A corresponding to a region with amino acids SSKKKDKKEQLSKAQKRKLADKTDHKGELPRGWNWVDVVKHLSKTGSKDD

<p>FASN antibody was raised in Rabbit using Human FASN as the immunogen</p>

<p>LSM2 antibody was raised using a synthetic peptide corresponding to a region with amino acids TDPEKYPHMLSVKNCFIRGSVVRYVQLPADEVDTQLLQDAARKEALQQKQ</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of CLIC3 antibody, catalog no. 70R-8068</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of POGK antibody, catalog no. 70R-8329</p>