Biochemicals and Reagents

Purified IgG protein (Human) (Fab'2)

A synthetic peptide for use as a blocking control in assays to test for specificity of CASD1 antibody, catalog no. 70R-7436

The IL2R alpha protein is a crucial component in Life Sciences research. It plays a vital role in immune response activation and regulation. This protein can be activated by the binding of specific antibodies, forming an antibody complex that aids in the identification and targeting of various pathogens, including cryptosporidium.

A synthetic peptide for use as a blocking control in assays to test for specificity of C6orf134 antibody, catalog no. 70R-1282

DCP1B antibody was raised in Rabbit using Human DCP1B as the immunogen

Purified Polyclonal PTGR2 antibody

Rabbit polyclonal IKK alpha/beta antibody for detection of the Phospho-Ser176 form of the IKK alpha/beta peptide.

A synthetic peptide for use as a blocking control in assays to test for specificity of CNTNAP4 antibody, catalog no. 70R-6128

Rabbit polyclonal PSMB10 antibody

A synthetic peptide for use as a blocking control in assays to test for specificity of RAB11FIP2 antibody, catalog no. 70R-4509

FBXL20 antibody was raised in rabbit using the middle region of FBXL20 as the immunogen

The STK24 antibody is a polyclonal antibody that is highly effective in targeting and neutralizing cytotoxic factors in various biological samples, including pleural fluid, human serum, and tissue culture media. This antibody specifically binds to STK24, a protein kinase involved in the regulation of cell growth and survival. By binding to STK24, this antibody inhibits its activity and prevents the downstream signaling pathways that promote cell proliferation and survival.

The ATXN1 antibody is a highly reactive and neutralizing polyclonal antibody that specifically targets the ATXN1 protein. This protein is involved in various cellular processes, including cell signaling and gene expression regulation. The ATXN1 antibody has been shown to be effective in blocking the activity of ATXN1, making it an ideal tool for studying its function and potential therapeutic applications. It can also be used as a diagnostic tool to detect the presence of autoantibodies against ATXN1 in human serum. The ATXN1 antibody is produced using advanced techniques and quality control measures to ensure its purity and specificity. With its high affinity and selectivity, this monoclonal antibody provides reliable results in various research settings.

A synthetic peptide for use as a blocking control in assays to test for specificity of BCAS2 antibody, catalog no. 70R-5000

Rabbit polyclonal FOXI1 antibody

Affinity purified Rabbit polyclonal HSPE1 antibody

A synthetic peptide for use as a blocking control in assays to test for specificity of YTHDF3 antibody, catalog no. 70R-3209

A synthetic peptide for use as a blocking control in assays to test for specificity of INTS6 antibody, catalog no. 70R-4691

Affinity purified Rabbit polyclonal Histone H2A.Z antibody

The Cytokeratin 20 antibody is a highly specific polyclonal antibody that targets the CD3 receptor. It can be used in various applications such as immunohistochemistry and flow cytometry. This antibody is reactive against alpha-fetoprotein and has been shown to have neutralizing properties. It can be used as a diagnostic reagent in the detection of certain diseases or conditions. The Cytokeratin 20 antibody is also useful in research settings for studying TGF-beta signaling, collagen synthesis, and other related processes. With its high specificity and versatility, this monoclonal antibody is a valuable tool for researchers and clinicians alike.

A synthetic peptide for use as a blocking control in assays to test for specificity of FNDC3B antibody, catalog no. 70R-1835

A synthetic peptide for use as a blocking control in assays to test for specificity of Gns antibody, catalog no. 70R-8622

PLP2 antibody was raised using a synthetic peptide corresponding to a region with amino acids LVERGNHSKIVAGVLGLIATCLFGYDAYVTFPVRQPRHTAAPTDPADGPV

A synthetic peptide for use as a blocking control in assays to test for specificity of 2610034B18Rik antibody, catalog no. 70R-9356

Rabbit polyclonal SNX3 antibody

The TCTP antibody is a biochemical agent that targets the hyperpolarization-activated protein kinase. It belongs to the group of polyclonal antibodies and can be used for various applications, including research and diagnostic purposes. This antibody specifically recognizes TCTP (Translationally Controlled Tumor Protein), which has been found to play a role in various cellular processes such as cell growth, proliferation, and apoptosis.

The NRGN antibody is a highly specialized polyclonal antibody that is used in various life sciences applications. It has been extensively tested and validated using electrochemical impedance spectroscopy, flow assays, and crystal microbalance techniques. This antibody is designed to specifically bind to the antigen binding domain of NRGN, a toxin subunit found in various organisms.

GFER antibody was raised in Rabbit using Human GFER as the immunogen

A synthetic peptide for use as a blocking control in assays to test for specificity of ZNF117 antibody, catalog no. 70R-8728

A synthetic peptide for use as a blocking control in assays to test for specificity of MAGEB1 antibody, catalog no. 70R-4382

A synthetic peptide for use as a blocking control in assays to test for specificity of SLC5A5 antibody, catalog no. 70R-6763

Rabbit polyclonal GABARAPL2 antibody (HRP)

A synthetic peptide for use as a blocking control in assays to test for specificity of ZNF418 antibody, catalog no. 70R-8986

CHIA antibody was raised in Rabbit using Human CHIA as the immunogen

A synthetic peptide for use as a blocking control in assays to test for specificity of TBC1D10A antibody, catalog no. 70R-10116

The ZKSCAN3 antibody is a glycoprotein that is activated by monoclonal antibodies. It belongs to the group of polyclonal antibodies used in life sciences research. This antibody has cytotoxic properties and can inhibit kinase activity. It is commonly used in studies involving cardiomyocytes and the mitogen-activated protein pathway. The ZKSCAN3 antibody can also be used as an inhibitor in experiments involving anti-CD20 antibodies. It has been shown to have high affinity for human serum albumin, making it a valuable tool for various research applications.

A synthetic peptide for use as a blocking control in assays to test for specificity of USP3 antibody, catalog no. 70R-8005

A synthetic peptide for use as a blocking control in assays to test for specificity of XPNPEP2 antibody, catalog no. 70R-5336

A synthetic peptide for use as a blocking control in assays to test for specificity of CCDC117 antibody, catalog no. 70R-9221

KRTAP1-5 antibody was raised in rabbit using the C terminal of KRTAP1-5 as the immunogen

ANKRA2 antibody was raised in rabbit using the C terminal of ANKRA2 as the immunogen

CENPC1 antibody was raised in Rabbit using Human CENPC1 as the immunogen

A synthetic peptide for use as a blocking control in assays to test for specificity of F10 antibody, catalog no. 70R-7485

A synthetic peptide for use as a blocking control in assays to test for specificity of COLEC12 antibody, catalog no. 70R-7929

The CMV gB antibody is a powerful tool in Life Sciences research. This monoclonal antibody specifically targets the glycoprotein B (gB) of cytomegalovirus (CMV), a common virus that can cause serious complications in immunocompromised individuals. The CMV gB antibody is highly specific and exhibits cytotoxic effects on CMV-infected cells, making it an essential reagent for studying CMV pathogenesis and developing antiviral therapies.

A synthetic peptide for use as a blocking control in assays to test for specificity of EXOC8 antibody, catalog no. 70R-4492

The RACGAP1 antibody is a powerful tool used in the field of Life Sciences for various applications. This antibody specifically targets RACGAP1, an important protein involved in cell division and migration. It can be used for research purposes such as hybridization studies, where it helps identify the expression patterns of RACGAP1 in different tissues and cell types.

Rabbit anti-goat IgG (Alk Phos) was raised in rabbit using goat IgG F(ab')2 fragment as the immunogen.

The Cathepsin D antibody is a highly sensitive detection tool commonly used in immunoassays within the Life Sciences industry. This antibody is designed to specifically target and bind to Cathepsin D, an enzyme involved in various cellular processes. Its ultrasensitive detection capabilities make it ideal for research and diagnostic applications.

Affinity purified Rabbit polyclonal PCMT1 antibody

MYL3 antibody was raised in Mouse using a purified recombinant fragment of MYL3 expressed in E. coli as the immunogen.

The NPY antibody is a powerful tool used in Life Sciences research. It is a polyclonal antibody that specifically targets and detects neuropeptide Y (NPY), a peptide involved in various physiological processes. This antibody can be used in assays to study the role of NPY in thrombocytopenia, choline acetyltransferase activity, growth factor signaling, and other cellular processes. The NPY antibody is highly specific and sensitive, allowing for accurate detection and quantification of NPY levels. It can be used in both monoclonal and polyclonal formats, depending on the specific research needs. This antibody has been extensively validated and proven to deliver reliable results. In addition to its use in research, the NPY antibody has potential applications in diagnostics and therapeutics. Its ability to target NPY makes it a valuable tool for developing targeted therapies for diseases associated with dysregulation of NPY signaling pathways. Overall, the NPY antibody is an essential tool for scientists working

Affinity purified Rabbit polyclonal EPH receptor A8 antibody

The SPTLC1 antibody is a highly specialized polyclonal antibody that plays a crucial role in various life science applications. It is designed to target and bind to the SPTLC1 protein, which is involved in the synthesis of sphingolipids, an essential component of cell membranes.

A synthetic peptide for use as a blocking control in assays to test for specificity of XRCC2 antibody, catalog no. 70R-5542

Purified Polyclonal Frizzled 8 antibody

Rabbit polyclonal PTPN18 antibody

A synthetic peptide for use as a blocking control in assays to test for specificity of EIF3E antibody, catalog no. 70R-3591

A synthetic peptide for use as a blocking control in assays to test for specificity of DDX17 antibody, catalog no. 70R-5026

A synthetic peptide for use as a blocking control in assays to test for specificity of PDK3 antibody, catalog no. 70R-2460

ZNF708 antibody was raised in rabbit using the N terminal of ZNF708 as the immunogen

A synthetic peptide for use as a blocking control in assays to test for specificity of PM20D2 antibody, catalog no. 70R-4116

The HSP40 antibody is a highly specialized product used in Life Sciences research. It is designed to target and bind to specific proteins known as heat shock proteins (HSPs) in human serum. These antibodies have been extensively studied and proven effective in various applications, including nuclear receptor studies, insulin signaling pathways, and caspase-9 activation.

Fibrinogen antibody was raised in sheep using human Fibrinogen purified from plasma as the immunogen.

The OR51E2 antibody is a highly specialized monoclonal antibody that is used in various Life Sciences applications. This antibody specifically targets and interacts with the OR51E2 protein, which plays a crucial role in cellular processes such as cell growth, proliferation, and differentiation.

A synthetic peptide for use as a blocking control in assays to test for specificity of CMTM2 antibody, catalog no. 70R-6338

A synthetic peptide for use as a blocking control in assays to test for specificity of CSNK1G1 antibody, catalog no. 20R-1168

A synthetic peptide for use as a blocking control in assays to test for specificity of NT5DC2 antibody, catalog no. 70R-4565

WFDC1 antibody was raised using the middle region of WFDC1 corresponding to a region with amino acids VAEGIPNRGQCVKQRRQADGRILRHKLYKEYPEGDSKNVAEPGRGQQKHF

Rabbit polyclonal TSG6 antibody

CDC73 antibody was raised in Rabbit using Human CDC73 as the immunogen

A synthetic peptide for use as a blocking control in assays to test for specificity of PABPC4 antibody, catalog no. 70R-4874

The iNOS antibody is a neuroprotective monoclonal antibody that targets inducible nitric oxide synthase (iNOS). It is commonly used in Life Sciences research and has shown promising results in various studies. This antibody specifically binds to iNOS, inhibiting its activity and preventing the production of nitric oxide. Nitric oxide is a signaling molecule that plays a role in various physiological processes, including inflammation and neuronal signaling. By blocking iNOS, the antibody can help reduce inflammation and protect neurons from damage.

The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the category of rifamycins. It is known to effectively treat tuberculosis infections by targeting active compounds and exhibiting bactericidal activity. Through its binding to DNA-dependent RNA polymerase, this drug inhibits bacterial growth, preventing transcription and replication. Its efficacy has been demonstrated through patch-clamp technique studies on human erythrocytes. The drug undergoes various metabolic transformations, including hydrolysis, oxidation, reduction, and conjugation with glucuronic acid. Additionally, it specifically binds to markers expressed in Mycobacterium tuberculosis strains, inhibiting their growth in culture.

SLC25A29 antibody was raised using the C terminal of SLC25A29 corresponding to a region with amino acids AEGWRVFTRGLASTLLRAFPVNAATFATVTVVLTYARGEEAGPEGEAVPA

hCG_20426 antibody was raised in rabbit using the C terminal of HCG_20426 as the immunogen

DLEU1 antibody was raised in Rabbit using Human DLEU1 as the immunogen

Mouse anti-25OH Vitamin D2/D3 antibody

A synthetic peptide for use as a blocking control in assays to test for specificity of DGAT2L3 antibody, catalog no. 70R-6781

TYRO3 antibody was raised in Mouse using purified recombinant extracellular fragment of human TYRO3 fused with hIgGFc tag expressed in HEK293 cell line as the immunogen.

A synthetic peptide for use as a blocking control in assays to test for specificity of MPST antibody, catalog no. 70R-2488

A synthetic peptide for use as a blocking control in assays to test for specificity of ZNF280C antibody, catalog no. 70R-8333

Affinity purified Rabbit polyclonal Tuftelin 1 antibody

Rabbit polyclonal PPP1R8 antibody

A synthetic peptide for use as a blocking control in assays to test for specificity of Loxl2 antibody, catalog no. 70R-9282

AHCY antibody was raised in Rabbit using Human AHCY as the immunogen

A synthetic peptide for use as a blocking control in assays to test for specificity of WDR21B antibody, catalog no. 70R-3331

Purified Polyclonal TCP1 theta antibody

ALDH4A1 antibody was raised in Rabbit using Human ALDH4A1 as the immunogen

The MDM2 antibody is a powerful tool used in Life Sciences research. It is a monoclonal antibody that specifically targets the MDM2 protein, which plays a crucial role in regulating cell growth and division. This antibody can be used to study the function of MDM2 in various cellular processes.

Region of Myostatin Propeptide beta protein corresponding to amino acids MNENSEQKEN VEKEGLCNAC TWRQNTKSSR IEAIKIQILS KLRLETAPNI SKDVIRQLLP KAPPLRELID QYDVQRDDSS DGSLEDDDYH ATTETIITMP TESDFLMQVD GKPKCCFFKF SSKIQYNKVV KAQLWIYLRP VETPTTVFVQ ILRLIKPMKD GTRYTGIRSL KLDMNPGTGI WQSIDVKTVL QNWLKQPESN LGIEIKALDE NGHDLAVTFP GPGEDGLNPF LEVKVTDTPK RSRR.