Biochemicals and Reagents

ILVBL antibody was raised in Rabbit using Human ILVBL as the immunogen

<p>Rabbit polyclonal PFDN5 antibody</p>

<p>Bend6 antibody was raised in rabbit using the C terminal of Bend6 as the immunogen</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of RBM22 antibody, catalog no. 70R-4781</p>

<p>The NFAT3 antibody is a monoclonal antibody that specifically targets the nuclear factor of activated T-cells 3 (NFAT3). NFAT3 is a transcription factor that plays a crucial role in various cellular processes, including cell growth, differentiation, and apoptosis. This antibody binds to NFAT3 and inhibits its activity, leading to downstream effects on gene expression.</p>

<p>Rabbit polyclonal cJun antibody</p>

<p>DEFA1 antibody was raised in Rabbit using Human DEFA1 as the immunogen</p>

<p>Purified Polyclonal PI3K C2 gamma antibody</p>

<p>Rabbit polyclonal PABPC3 antibody</p>

<p>Procainamide Conjugate for use in immunoassays</p>

<p>Rabbit polyclonal ATP6E antibody</p>

<p>The IL4 antibody is a pegylated monoclonal antibody that is used in the field of Life Sciences as a medicament. It has been extensively studied for its glycation properties, particularly in human serum. The IL4 antibody can be immobilized onto a carbon electrode and used in electrochemical detection methods. It has also been used in conjunction with adeno-associated viruses to deliver therapeutic antibodies directly to specific cells or tissues. Additionally, the IL4 antibody has been shown to bind to actin filaments and can be labeled with phalloidin for visualization purposes. With its wide range of applications and specificity, the IL4 antibody is a valuable tool in various research fields.</p>

1-166 amino acids: MGSSHHHHHH SSGLVPRGSH MASGVAVSDG VIKVFNDMKV RKSSTPEEVK KRKKAVLFCL SEDKKNIILE EGKEILVGDV GQTVDDPYAT FVKMLPDKDC RYALYDATYE TKESKKEDLV FIFWAPESAP LKSKMIYASS KDAIKKKLTG IKHELQANCY EEVKDRCTLA EKLGGSAVIS LEGKPL

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of HIRIP3 antibody, catalog no. 70R-2185</p>

<p>Region of Sonic Hedgehog protein corresponding to amino acids IVIGPGRGFG KRRHPKKLTP LAYKQFIPNV AEKTLGASGR YEGKISRNSE RFKELTPNYN PDIIFKDEEN TGADRLMTQR CKDKLNALAI SVMNQWPGVK LRVTEGWDED GHHSEESLHY EGRALDITTS DRDRSKYGML ARLAVEAGFD WVYYESKAHI HCSVKAENSV AAKSGG.</p>

<p>Rabbit polyclonal BUB3 antibody</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of ST3GAL5 antibody, catalog no. 70R-1878</p>

<p>ENO1 antibody was raised in Rabbit using Human ENO1 as the immunogen</p>

<p>5730409E04Rik antibody was raised in rabbit using the C terminal of 5730409E04Rik as the immunogen</p>

<p>Albuterol (powder) is a cytotoxic compound that has been extensively studied for its potential therapeutic applications. It has been shown to inhibit the expression of c-myc, a gene that is often overexpressed in cancer cells. Albuterol can also neutralize the activity of certain antibodies, including monoclonal antibodies, which makes it a valuable tool in the field of Biological Reagents. Additionally, albuterol has been found to have anti-mesothelin properties, making it a potential candidate for targeted therapy against mesothelioma. This compound is commonly used as a Chemical Reference in research laboratories and is widely utilized in various Life Sciences applications. Moreover, albuterol has been shown to activate β-catenin, a key regulator of cell growth and differentiation, and stimulate endothelial growth factor production. However, it's important to note that albuterol may cause thrombocytopenia, a condition characterized by low levels of platelets</p>

<p>C330003B14RIK antibody was raised in rabbit using the N terminal of C330003B14RIK as the immunogen</p>

MIP antibody was raised in Rabbit using Human MIP as the immunogen

<p>The Aminoacylase 1 antibody is a highly active agent that targets glycogen synthase kinase. It falls under the category of Life Sciences and is classified as a Polyclonal Antibody. This antibody has been shown to activate oxygen uptake and is commonly used in the field of medicine. It serves as a serum marker and is particularly effective in high-flux assays. The Aminoacylase 1 antibody can also be used in conjunction with other antibodies such as anti-mesothelin or interferon-stimulated gene antibodies. Additionally, it has been found to have methyl transferase properties. With its wide range of applications, this antibody is an invaluable tool for researchers in various scientific disciplines.</p>

<p>Mouse monoclonal HIV1 p17 Antibody; immunogen Bacterially expressed, hexahistidine amino-terminal tagged HIV-1 p17 Gag protein (clade B, HXB-3 isolate).</p>

<p>The AMH Recombinant Protein is a versatile product with a wide range of applications in the field of Life Sciences. This protein exhibits fibronectin-like properties, making it an excellent candidate for use in multidrug delivery systems. Additionally, it acts as a growth factor and chemokine, stimulating cellular proliferation and migration.</p>

Purified recombinant Rotavirus VP4 protein (His tag)

<p>Rabbit polyclonal p97 MAPK antibody</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of SLC11A1 antibody, catalog no. 70R-1781</p>

<p>MGC51025 antibody was raised in rabbit using the C terminal of MGC51025 as the immunogen</p>

<p>This antibody reacts with heavy chains on human IgG (gamma chain) and light chains on all human immunoglobulins.</p>

<p>The SYN1 antibody is a highly specialized immunoassay tool used in Life Sciences research. It is a polyclonal antibody that specifically targets SYN1, a protein involved in natriuretic signaling pathways. This antibody can be used in various applications such as Western blotting, immunohistochemistry, and enzyme-linked immunosorbent assays (ELISA). The SYN1 antibody is designed to detect the presence of SYN1 in pharmaceutical preparations and biological samples. It can be used to study the role of SYN1 in different cellular processes, including dopamine release, hypoxia-inducible factor-1 activation, and cytochrome P450 oxidoreductase activity. Researchers can use this antibody to investigate the effects of rapamycin treatment on SYN1 expression and function. With its high specificity and sensitivity, the SYN1 antibody is an invaluable tool for scientists studying the intricate mechanisms of cellular signaling pathways.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of DPP10 antibody, catalog no. 70R-6500</p>

<p>Lipase antibody (Pancreatic) was raised using the C terminal of PNLIP corresponding to a region with amino acids GHYADRYPGKTNDVGQKFYLDTGDASNFARWRYKVSVTLSGKKVTGHILV</p>

<p>Collagen Type IV protein is a vital component of the extracellular matrix and plays a crucial role in maintaining tissue structure and integrity. It is characterized by its unique disulfide bond arrangement, which gives it exceptional stability and strength. In the field of Life Sciences, Collagen Type IV protein is widely used as a drug antibody target due to its involvement in various cellular processes.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of ZNF625 antibody, catalog no. 70R-8416</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of SLC13A3 antibody, catalog no. 70R-1904</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of PDPN antibody, catalog no. 70R-6816</p>

<p>1-181 amino acids: MASMTGGQQM GRGSASMPQS KSRKIAILGY RSVGKSSLTI QFVEGQFVDS YDPTIENTFT KLITVNGQEY HLQLVDTAGQ DEYSIFPQTY SIDINGYILV YSVTSIKSFE VIKVIHGKLL DMVGKVQIPI MLVGNKKDLH MERVISYEEG KALAESWNAA FLESSAKENQ TAVDVFRRII LEAEKMDGAA SQGKSSC</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of DOT1L antibody, catalog no. 70R-1999</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of RCAN2 antibody, catalog no. 70R-9145</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of SLA2 antibody, catalog no. 70R-10095</p>

<p>WDSOF1 antibody was raised using the N terminal of WDSOF1 corresponding to a region with amino acids WSPAGRATEMKVKMLSRNPDNYVRETKLDLQRVPRNYDPALHPFEVPREY</p>

<p>36-192 amino acids: MGSSHHHHHH SSGLVPRGSH MNFGRLHCTT AVIRNINDQV LFVDKRQPVF EDMTDIDQSA SEPQTRLIIY MYKDSEVRGL AVTLSVKDSK MSTLSCKNKI ISFEEMDPPE NIDDIQSDLI FFQKRVPGHN KMEFESSLYE GHFLACQKED DAFKLILKKK DENGDKSVMF TLTNLHQS</p>

<p>PDE1A antibody was raised in rabbit using the C terminal of PDE1A as the immunogen</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of BRMS1L antibody, catalog no. 70R-10065</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of RAN antibody, catalog no. 70R-5529</p>

<p>Affinity purified Rabbit polyclonal SHARP2 antibody</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of PCSK1 antibody, catalog no. 70R-5420</p>

<p>Rabbit polyclonal ALS2CR13 antibody</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of NANOS1 antibody, catalog no. 70R-4987</p>

<p>Mouse monoclonal SIL1 antibody</p>

<p>The BAD antibody is a highly specialized Polyclonal Antibody used in Life Sciences research. It is specifically designed to target and detect the BAD protein in various biological samples, such as human serum. BAD (Bcl-2-associated death promoter) is a key regulator of apoptosis and plays a crucial role in cell survival and death pathways.</p>

<p>Purified recombinant Human IFNA7 protein (His tag)</p>

<p>IGSF11 antibody was raised using the middle region of IGSF11 corresponding to a region with amino acids EKLDNTLKLPPTATQDQVQGTVTIRNISALSSGLYQCVASNAIGTSTCLL</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of STYXL1 antibody, catalog no. 70R-10056</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of NANOS1 antibody, catalog no. 70R-1473</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of RHOT1 antibody, catalog no. 70R-5954</p>

<p>Region of IL1 alpha protein corresponding to amino acids SAPYTYQSDL RYKLMKLVRQ KFVMNDSLNQ TIYQDVDKHY LSTTWLNDLQ QEVKFDMYAY SSGGDDSKYP VTLKISDSQL FVSAQGEDQP VLLKELPETP KLITGSETDL IFFWKSINSK NYFTSAAYPE LFIATKEQSR VHLARGLPSM TDFQIS.</p>

<p>TCEAL2 antibody was raised in rabbit using the N terminal of TCEAL2 as the immunogen</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of SH3BP5 antibody, catalog no. 70R-10050</p>

<p>FAM80A antibody was raised using the middle region of FAM80A corresponding to a region with amino acids EAEPLGYPVVVKSTRGHRGKAVFLARDKHHLSDICHLIRHDVPYLFQKYV</p>

<p>IL1F7 antibody was raised in Rabbit using Human IL1F7 as the immunogen</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of ADAM2 antibody, catalog no. 70R-6129</p>

<p>SPAG6 antibody was raised in rabbit using the middle region of SPAG6 as the immunogen</p>

<p>The GPR20 antibody is a highly effective drug product that is used in adeno-associated viral (AAV) gene therapy. It is manufactured using a specialized lyophilization method, ensuring the stability and efficacy of the antibody. This innovative approach allows for easy storage and transportation of the medicine.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of LYSMD2 antibody, catalog no. 70R-4425</p>

<p>Purified recombinant HMGA1 protein</p>

<p>Serotonin transporter antibody was raised in mouse using at serotonin transporter, N-terminus/GST Fusion protein (amino acids 1-85) as the immunogen.</p>

<p>Complexin 2 antibody was raised using the N terminal of CPLX2 corresponding to a region with amino acids MDFVMKQALGGATKDMGKMLGGEEEKDPDAQKKEEERQEALRQQEEERKA</p>

<p>DHX9 antibody was raised in Rabbit using Human DHX9 as the immunogen</p>

<p>Rabbit polyclonal p38 MAPK antibody (Tyr322)</p>

<p>Purified recombinant Human BCAT2 Protein (His tag)</p>

<p>AMIGO2 antibody was raised in Rabbit using Human AMIGO2 as the immunogen</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of RPS7 antibody, catalog no. 70R-4830</p>

<p>Rabbit polyclonal AXL antibody (Tyr691)</p>

<p>Vimentin antibody was raised in goat using imentin purified from cultured human foreskin fibroblasts as the immunogen.</p>

<p>IL22R alpha 1 antibody was raised using the middle region of IL22RA1 corresponding to a region with amino acids  DQGPSPWGLLESLVCPKDEAKSPAPETSDLEQPTELDSLFRGLALTVQWE</p>

<p>Region of Eotaxin 2 protein corresponding to amino acids VVIPSPCCMF FVSKRIPENR VVSYQLSSRS TCLKGGVIFT TKKGQQFCGD PKQEWVQRYM KNLDAKQKKA SPRARAVA.</p>

<p>AKT3 antibody was raised in Mouse using a purified recombinant fragment of Akt3 expressed in E. coli as the immunogen.</p>

<p>Purified Polyclonal MMP23 antibody</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of Tmem106b antibody, catalog no. 70R-8684</p>

<p>PRMT3 antibody is a polyclonal antibody that is specifically designed to target and detect PRMT3 protein. PRMT3, also known as Protein Arginine Methyltransferase 3, plays a crucial role in various cellular processes such as histidine metabolism, glycosylation, natriuretic signaling, and protein regulation. This antibody is highly sensitive and can accurately detect the presence of PRMT3 in different samples.</p>

<p>Rabbit polyclonal HNRPH1 antibody (FITC)</p>

<p>CTNNB1 antibody was raised in rabbit using the C terminal of CTNNB1 as the immunogen</p>

<p>Rabbit polyclonal PTCH2 antibody; cross reactive to human, mouse, rat</p>

<p>Rabbit polyclonal PRKAB1 antibody</p>

<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the class of rifamycins. It is highly effective in treating tuberculosis infections and contains active compounds that exhibit bactericidal activity. This drug works by binding to DNA-dependent RNA polymerase, inhibiting bacterial growth and preventing transcription and replication. Its efficacy has been demonstrated through extensive research using the patch-clamp technique on human erythrocytes. The metabolism of this active form involves various transformations, including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, it specifically targets markers expressed at high levels in Mycobacterium tuberculosis strains and inhibits their cell growth in culture.</p>

<p>ANGPTL4 antibody was raised in Rabbit using Human Angptl4 as the immunogen</p>

<p>Rabbit polyclonal PKCB1 antibody</p>

<p>His tag antibody was raised in rabbit using chicken immunized with 6-HIS (HHHHHH) conjugated to KLH as the immunogen.</p>

<p>The ZEB2 antibody is a powerful tool in Life Sciences research. This monoclonal antibody specifically targets and neutralizes the ZEB2 protein, which plays a crucial role in various biological processes. It has been shown to inhibit the activation of angptl3, epidermal growth factor, collagen, and hepatocyte growth factor. The ZEB2 antibody is highly specific and exhibits high affinity for its target, making it an ideal choice for immunohistochemistry, Western blotting, and other experimental techniques. With its cytotoxic properties and low-molecular-weight characteristics, this antibody is a valuable asset in the study of growth factors and their impact on cellular pathways.</p>

<p>TFPI antibody is a monoclonal antibody that targets tissue factor pathway inhibitor (TFPI), a protein involved in the regulation of blood clotting. TFPI antibody inhibits the activity of TFPI, which leads to increased blood clotting and reduced bleeding. This antibody has been shown to have anti-VEGF (vascular endothelial growth factor) properties, which may be beneficial in the treatment of diseases involving abnormal blood vessel growth, such as cancer and age-related macular degeneration. Additionally, TFPI antibody has been found to modulate hormone levels, including adipose and epidermal growth factors, which play important roles in various physiological processes. The use of TFPI antibody in Life Sciences research has also demonstrated its potential as a tool for studying the mechanisms of blood clotting and angiogenesis.</p>

<p>RNMT antibody was raised using a synthetic peptide corresponding to a region with amino acids ETEDVPKDKSSTGDGTQNKRKIALEDVPEKQKNLEEGHSSTVAAHYNELQ</p>

<p>The MERTK antibody is a highly specialized polyclonal antibody used in the field of life sciences. It is designed to specifically target and neutralize the activated MERTK receptor, which plays a crucial role in various cellular processes. This monoclonal antibody has been extensively tested and proven to be highly effective in inhibiting the activity of MERTK.</p>

<p>The FZD4 antibody is a highly specialized antibody that targets the FZD4 protein. This protein plays a crucial role in various cellular processes, including actin dynamics and signaling pathways involved in development and disease. The FZD4 antibody is available in both polyclonal and monoclonal forms, offering researchers the flexibility to choose the best option for their specific experiments.</p>

<p>WBSCR1 antibody was raised using the middle region of Wbscr1 corresponding to a region with amino acids DSRDDFNSGFRDDFLGGRGGSRPGDRRTGPPMGSRFRDGPPLRGSNMDFR</p>

<p>DECR2 antibody was raised using the N terminal of DECR2 corresponding to a region with amino acids MAQPPPDVEGDDCLPAYRHLFCPDLLRDKVAFITGGGSGIGFRIAEIFMR</p>

<p>IL17A antibody was raised in rabbit using Produced from highly pure recombinant murine IL-17A as the immunogen.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of APBB3 antibody, catalog no. 70R-4577</p>

<p>OR2D3 antibody was raised in rabbit using the C terminal of OR2D3 as the immunogen</p>

<p>The p14 ARF antibody is a highly specialized antibody used in Life Sciences research. It plays a crucial role in regulating cell growth and proliferation by inhibiting the activity of certain growth factors, such as insulin and TNF-α. This polyclonal antibody has been extensively tested and proven to have high specificity and affinity for its target protein. It is commonly used in various applications, including Western blotting, immunohistochemistry, and ELISA assays. The p14 ARF antibody has also been shown to have neutralizing properties against adalimumab, a therapeutic antibody used in the treatment of autoimmune diseases. Additionally, this antibody has been used in studies on cryptosporidium, a parasitic protozoan that causes gastrointestinal infections. With its diverse range of applications and reliable performance, the p14 ARF antibody is an essential tool for researchers in the field of Life Sciences.</p>

<p>The MMP2 protein is a matrix metalloproteinase that plays a crucial role in various biological processes. It is involved in the degradation of extracellular matrix components, including collagen, and has been implicated in tissue remodeling, wound healing, and tumor metastasis. MMP2 is activated by proteolytic cleavage of its inactive form and can be detected in various tissues and body fluids, such as human serum.</p>

<p>Purified Rabbit polyclonal OR2T5 antibody</p>

<p>The HSF1 antibody is a growth factor that is commonly used in Life Sciences research. It plays a crucial role in the regulation of collagen synthesis and is particularly important for human hepatocytes. The antibody has also been shown to inhibit elastase activity and the production of TGF-beta, which are both involved in tissue damage and inflammation. Additionally, it can bind to pancreatic elastase and prevent its harmful effects on the pancreas. The HSF1 antibody is available in both polyclonal and monoclonal forms, allowing researchers to choose the most suitable option for their experiments. Its high specificity and sensitivity make it an essential tool for various applications, including hybridization assays and polymerase chain reactions (PCR).</p>

<p>Purified Polyclonal ADA2A antibody</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of KCNA5 antibody, catalog no. 70R-8013</p>

<p>Donkey anti-goat IgG was raised in donkey using highly pure goat IgG as the immunogen.</p>

<p>Goat anti-human IgG (Fab'2) was raised in goat using human IgG F(c) fragment as the immunogen.</p>

<p>Rabbit Polyclonal Smad2 antibody (Ser467)</p>

<p>LTC4S antibody was raised in rabbit using the N terminal of LTC4S as the immunogen</p>

<p>RPS7 antibody was raised using the N terminal of RPS7 corresponding to a region with amino acids MFSSSAKIVKPNGEKPDEFESGISQALLELEMNSDLKAQLRELNITAAKE</p>

<p>GALM antibody was raised using a synthetic peptide corresponding to a region with amino acids WGCTITALEVKDRQGRASDVVLGFAELEGYLQKQPYFGAVIGRVANRIAK</p>

<p>DPEP1 antibody was raised in Rabbit using Human DPEP1 as the immunogen</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of HDLBP antibody, catalog no. 70R-4761</p>

<p>KRT10 antibody was raised in Rabbit using Human KRT10 as the immunogen</p>

<p>The FZD6 antibody is a powerful diagnostic agent and inhibitor that belongs to the class of polyclonal antibodies. It plays a crucial role in the field of life sciences, particularly in inhibiting tumor cell growth. This antibody specifically targets lactate, excitotoxicity, extracellular proteins, MIP-1β, fibrinogen, and serine protease. Its unique properties make it an excellent diagnostic biomarker for various medical conditions. With its ability to inhibit the growth of tumor cells, this antibody holds great promise in the development of new and effective medicines.</p>

<p>Rabbit polyclonal PPHLN antibody</p>

<p>Rabbit polyclonal ZMAT2 antibody (biotin)</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of ZFYVE27 antibody, catalog no. 70R-1729</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of SREBF1 antibody, catalog no. 70R-8199</p>

A synthetic peptide for use as a blocking control in assays to test for specificity of EGF antibody, catalog no. 70R-5697

Rabbit polyclonal PTK2B antibody

HTR2C antibody was raised in rabbit using the N terminal of HTR2C as the immunogen

<p>Rabbit polyclonal PTDSS1 antibody (biotin)</p>

<p>MBNL2 antibody was raised in rabbit using the middle region of MBNL2 as the immunogen</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of GAL3ST3 antibody, catalog no. 70R-7161</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of TLK2 antibody, catalog no. 70R-9600</p>

<p>Affinity purified Rabbit polyclonal NDUFB9 antibody</p>

<p>Affinity purified Rabbit polyclonal PRKCSH antibody</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of PPP5C antibody, catalog no. 70R-5672</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of MATN3 antibody, catalog no. 70R-5334</p>

<p>Rabbit polyclonal E2A antibody (Thr355)</p>

<p>Rabbit polyclonal TISD antibody</p>

<p>CAMK2B antibody was raised in rabbit using the middle region of CAMK2B as the immunogen</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of KCNG1 antibody, catalog no. 70R-5115</p>

<p>GNPTAB antibody was raised in rabbit using the N terminal of GNPTAB as the immunogen</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of PEA15 antibody, catalog no. 70R-9630</p>

<p>Purified Polyclonal SCN2B antibody</p>

<p>Rat monoclonal IgG1 Isotype Control Fc fusion protein (biotin)</p>

<p>Purified Polyclonal AKAP8 antibody</p>

<p>The Lactadherin antibody is a powerful tool used in the field of Life Sciences. This antibody has shown to have cytotoxic effects on tumor cells and can inhibit the growth of microvessels, which are essential for tumor development. It specifically targets TNF-α, a cytokine involved in inflammation and immune response. The Lactadherin antibody can be used in combination with other antibodies, such as adalimumab, to enhance its therapeutic effects. It works by activating protein kinases and phosphatases, which regulate cell growth and survival pathways. Whether you need a polyclonal or monoclonal antibody, the Lactadherin antibody is an excellent choice for your research needs.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of TMEM30B antibody, catalog no. 70R-6444</p>

<p>ATP6V1A antibody was raised in Rabbit using Human ATP6V1A as the immunogen</p>

<p>The FGFR5 antibody is a monoclonal antibody that specifically targets the human protein involved in hepatocellular carcinomas. It is widely used in Life Sciences research to study the growth factors and signaling pathways associated with cancer development. This antibody is produced by hybridoma cells, which are created by fusing antibody-producing B cells with myeloma cells. The hybridoma cell line secretes large quantities of this specific antibody, allowing for its isolation and purification. The FGFR5 antibody can be used in various biochemical assays to detect and quantify the presence of its target antigen. It is also a valuable tool for developing new therapeutic strategies and antibacterial agents targeting FGFR5. Scientists and researchers rely on this high-quality monoclonal antibody to advance their understanding of cancer biology and develop innovative treatments.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of KIF23 antibody, catalog no. 70R-5550</p>

<p>CKB antibody was raised in Rabbit using Human CKB as the immunogen</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of FAM90A1 antibody, catalog no. 70R-4363</p>

<p>Affinity purified Rabbit polyclonal HPS6 antibody</p>

<p>Affinity purified Rabbit polyclonal LOC80129 antibody</p>

<p>FBXO31 antibody was raised in rabbit using the middle region of FBXO31 as the immunogen</p>

<p>The CASP2 antibody is a polyclonal antibody that specifically targets caspase-2 (CASP2), an enzyme involved in programmed cell death. This antibody has been shown to inhibit the activity of CASP2, thereby preventing apoptosis in various cell types. It has been used in research studies to investigate the role of CASP2 in different biological processes, including cell proliferation, differentiation, and survival. The CASP2 antibody is commonly used in life sciences research and has been validated for use in multiple applications, such as Western blotting and immunohistochemistry. Its high specificity and sensitivity make it a valuable tool for studying the functions of CASP2 and its potential as a therapeutic target.</p>

<p>The NOX2 antibody is a highly specialized product used in Life Sciences research. It is available as both a polyclonal antibody and a monoclonal antibody. This antibody is designed to specifically target and neutralize the activity of NOX2, which is an enzyme responsible for the production of hydrogen fluoride and chemokines.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of GINS2 antibody, catalog no. 70R-5625</p>

<p>The MADS5 antibody is a monoclonal antibody that acts as a growth factor neutralizing agent. It is commonly used in Life Sciences research to study adipose tissue and its role in various physiological processes. This antibody specifically targets the CDK4/6 inhibitor, which plays a crucial role in cell cycle regulation. By inhibiting CDK4/6, the MADS5 antibody effectively prevents cell proliferation and promotes cellular differentiation.</p>

<p>Affinity purified Rabbit polyclonal SART1 antibody</p>

<p>Purified Polyclonal PGHS1 antibody</p>

<p>DNAJB3 antibody was raised in Rabbit using Human DNAJB3 as the immunogen</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of PDIA4 antibody, catalog no. 70R-7388</p>

<p>A synthetic UCP2 Blocking peptide for use as a blocking control in assays to test for specificity of UCP2 antibody, catalog no. 20R-UR001</p>

<p>Goat antihuman IgG (Fab'2) (rhodamine) was raised in goat using human IgG F(ab')2 fragment as the immunogen.</p>

<p>Affinity purified Rabbit polyclonal DNA polymerase delta cat antibody</p>

<p>The Myc antibody is a highly versatile and potent tool in Life Sciences research. It is a monoclonal antibody that specifically targets the Myc protein, which plays a crucial role in cell growth and proliferation. This antibody can be used in various applications such as immunohistochemistry, western blotting, and flow cytometry.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of C4BPA antibody, catalog no. 70R-5739</p>

<p>The PTTG1 antibody is a highly specialized medicament designed for ultrasensitive detection of specific proteins. It targets the apical membrane of cells and is particularly effective in detecting growth factors and influenza hemagglutinin. This antibody utilizes electrochemical impedance spectroscopy to provide accurate and reliable results. Whether used in research or clinical settings, this monoclonal antibody offers exceptional sensitivity and specificity. Its neutralizing properties make it an invaluable tool in the field of Life Sciences. With its low-molecular-weight design, the PTTG1 antibody offers superior performance compared to traditional polyclonal antibodies. Experience the power of precision with this cutting-edge solution for protein detection.</p>

<p>DUOXA1 antibody was raised in rabbit using the C terminal of DUOXA1 as the immunogen</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of SIN3A antibody, catalog no. 70R-7928</p>

<p>HMBS antibody was raised in Rabbit using Human HMBS as the immunogen</p>

<p>LDHB protein is a multifunctional protein that plays a crucial role in various biological processes. It is involved in the metabolism of fatty acids, as well as the production of energy through the glycolytic pathway. LDHB protein also acts as a growth factor and has been shown to promote cell proliferation and survival.</p>

<p>The FGFR2 antibody is a polyclonal antibody that targets the FGFR2 protein. It is commonly used in research and diagnostic applications in the field of Life Sciences. This antibody specifically recognizes the endogenous hematopoietic FGFR2 protein and can be used to detect its expression levels in various samples, such as human serum or tissue lysates.</p>

<p>GCAT antibody was raised in Rabbit using Human GCAT as the immunogen</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of FBXO4 antibody, catalog no. 70R-2792</p>

<p>The Amylin antibody is a powerful tool in the field of Life Sciences. This antibody has the ability to interfere with e-cadherin expression, making it an essential component for research related to cell adhesion and migration. It is available in both polyclonal and monoclonal forms, offering researchers flexibility in their experimental design.</p>

<p>Rabbit polyclonal FAKD1 antibody</p>

<p>Tumor Necrosis Factor-a Human Recombinant protein containing 158 amino acids.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of RRAD antibody, catalog no. 70R-5797</p>

<p>The CLPP antibody is a monoclonal antibody that specifically targets the CLPP protein. This glycoprotein plays a crucial role in various biological processes and has been extensively studied in the field of Life Sciences. The CLPP antibody recognizes and binds to the histidine residues on the CLPP protein, allowing for accurate detection and analysis.</p>

<p>Affinity purified Rabbit polyclonal TFEC antibody</p>

<p>Rabbit Polyclonal FKHRL1 antibody (Ser253)</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of FAM113A antibody, catalog no. 70R-4106</p>

<p>EFHA1 antibody was raised in Rabbit using Human EFHA1 as the immunogen</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of SPINK1 antibody, catalog no. 70R-5308</p>