Biochemicals and Reagents

<p>Rabbit polyclonal MPZ antibody (FITC)</p>

<p>Met antibody is a polyclonal antibody that targets the Met receptor, also known as hepatocyte growth factor receptor (HGFR). This antibody specifically binds to the extracellular domain of the Met receptor and inhibits its activation. The Met receptor plays a crucial role in cell proliferation, survival, migration, and angiogenesis. It is involved in various physiological processes such as tissue regeneration, embryonic development, and wound healing. Dysregulation of the Met receptor has been implicated in various diseases, including cancer.</p>

<p>EDN3 antibody was raised in Rabbit using Human EDN3 as the immunogen</p>

<p>Rabbit polyclonal Rab1A antibody (biotin)</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of SERPINA5 antibody, catalog no. 70R-5417</p>

<p>THEG antibody was raised in rabbit using the middle region of THEG as the immunogen</p>

<p>Purified Polyclonal CUGBP1 antibody</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of SPRY2 antibody, catalog no. 70R-8918</p>

<p>Rabbit polyclonal CASP1 antibody</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of CKAP2 antibody, catalog no. 70R-10393</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of VPS37A antibody, catalog no. 70R-2831</p>

<p>Mouse monoclonal IgG2b Isotype Control Fc fusion protein (allophycocyanin)</p>

<p>GNAS antibody was raised using the N terminal of GNAS corresponding to a region with amino acids SGKSTIVKQMRILHVNGFNGDSEKATKVQDIKNNLKEAIETIVAAMSNLV</p>

<p>ZRSR2 antibody was raised using a synthetic peptide corresponding to a region with amino acids HHDDYYSRLRGRRNPSPDHSYKRNGESERKSSRHRGKKSHKRTSKSRERH</p>

<p>Metadherin antibody was raised in Mouse using a purified recombinant fragment of human MTDH expressed in E. coli as the immunogen.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of HIST1H2AE antibody, catalog no. 70R-10218</p>

<p>The Met antibody is a highly activated antibody that targets the hepatocyte growth factor receptor, also known as Met. It plays a crucial role in various cellular processes such as cell growth, survival, and migration. The Met antibody has been extensively studied for its potential therapeutic applications in cancer treatment.</p>

<p>HRP conjugated pure Human Albumin</p>

<p>317-454 amino acids: MAANKRKNQN RNKSSSHQDS SRMSSVGDYN TSEQKQACKK HELYVSFRDL GWQDWIIAPE GYAAFYCDGE CSFPLNAHMN ATNHAIVQTL VHLMFPDHVP KPCCAPTKLN AISVLYFDDS SNVILKKYRN MVVRSCGCH</p>

<p>Rabbit polyclonal OR2A42 antibody</p>

<p>The ARG2 antibody is a highly specialized antibody that has a wide range of applications in the field of life sciences. It is commonly used in various assays and experiments to study the role of ARG2 in different biological processes.</p>

<p>Rabbit polyclonal Transgelin antibody (HRP)</p>

<p>Purified recombinant GCG protein</p>

<p>MLL antibody was raised in Mouse using a purified recombinant fragment of MLL(aa3751-3968) expressed in E. coli as the immunogen.</p>

<p>Purified recombinant Human PYCR1 protein</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of VMD2L2 antibody, catalog no. 70R-1494</p>

<p>The Caspase 14 antibody is a specialized antibody that targets the kinase m2 enzyme. It is designed to detect and bind to specific cell antibodies, allowing for the identification and analysis of various cellular processes. This antibody has been extensively tested and validated using human serum samples, ensuring its reliability and accuracy in research applications.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of PAIP2 antibody, catalog no. 70R-9375</p>

<p>ROR1 antibody was raised in Mouse using recombinant extracellular fragment of human ROR1 (aa30-406) fused with hIgGFc tag, expressed in HEK293 cells as the immunogen.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of ATP8B2 antibody, catalog no. 70R-4519</p>

<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the class of rifamycins. It is highly effective in treating tuberculosis infections and contains active compounds that exhibit bactericidal activity. By binding to DNA-dependent RNA polymerase, this drug inhibits bacterial growth, preventing transcription and replication. Its potency has been demonstrated using a patch-clamp technique on human erythrocytes. The active form of this drug undergoes various metabolic transformations, including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, it specifically targets markers expressed in Mycobacterium tuberculosis strains and inhibits cell growth in culture.</p>

<p>EZH2 antibody was raised in Rabbit using Human EZH2 as the immunogen</p>

<p>Purified Polyclonal BCLAF1 antibody</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of RASGRF1 antibody, catalog no. 70R-9407</p>

<p>Purified recombinant Human BCL2A1 Protein (His tag)</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of TNNT3 antibody, catalog no. 70R-1233</p>

<p>Recombinant human SHMT1 protein (His tag)</p>

<p>The FOXP2 antibody is a highly specialized microparticle used in Life Sciences research. It is a polyclonal antibody that specifically targets the FOXP2 protein, which plays a crucial role in various cellular processes. This antibody can be used in applications such as transcription-polymerase chain reaction (PCR), interferon assays, and antigen-antibody reactions.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of SLC15A4 antibody, catalog no. 70R-6547</p>

<p>COQ9 antibody was raised in Rabbit using Human COQ9 as the immunogen</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of NOSIP antibody, catalog no. 70R-2310</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of ALDOC antibody, catalog no. 70R-2334</p>

<p>CD80 antibody was raised in Mouse using a purified recombinant fragment of CD80 expressed in E. coli as the immunogen.</p>

<p>Claudin 9 antibody was raised using the C terminal of CLDN9 corresponding to a region with amino acids WAAAALLMLGGGLLCCTCPPPQVERPRGPRLGYSIPSRSGASGLDKRDYV</p>

<p>ARHGAP18 antibody was raised in Rabbit using Human ARHGAP18 as the immunogen</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of GALNT5 antibody, catalog no. 70R-7239</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of SERPINB5 antibody, catalog no. 70R-1273</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of SFRS2B antibody, catalog no. 70R-4662</p>

<p>Region of Betacellulin protein corresponding to amino acids DGNSTRSPET NGLLCGDPEE NCAATTTQSK RKGHFSRCPK QYKHYCIKGR CRFVVAEQTP SCVCDEGYIG ARCERVDLFY.</p>

<p>The Cortactin antibody is a highly specialized product in the field of Life Sciences. It is an acidic growth factor that plays a crucial role in cellular processes such as cell migration, adhesion, and invasion. This Polyclonal Antibody specifically targets the activated form of Cortactin and can be used for various applications including immunoassays, western blotting, and immunofluorescence.</p>

<p>The beta Catenin antibody is a powerful tool used in Life Sciences research. It specifically targets the nuclear β-catenin and forms an antibody complex, allowing for the detection and analysis of this important protein. The beta Catenin antibody can be used in various applications such as transcription-polymerase chain reaction (PCR), bioassays, immunoassays, and more. Its high specificity and sensitivity make it an ideal choice for studying the role of β-catenin in cellular processes, including pluripotent stem cell differentiation and development. This antibody is available in both polyclonal and monoclonal forms to suit different experimental needs. With its ability to detect surface glycoproteins and cox-2 inhibitors, the beta Catenin antibody is an essential tool for researchers looking to gain insights into cellular signaling pathways and molecular interactions.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of Trim3 antibody, catalog no. 70R-9562</p>

<p>Purified Polyclonal TAF6L antibody</p>

<p>The VDAC1 antibody is a specific monoclonal antibody that is used as a molecular drug in the field of Life Sciences. It has been extensively studied for its ability to target and neutralize antiphospholipid antibodies, which are known to have procoagulant and anticoagulant effects. The VDAC1 antibody has also been shown to inhibit protein kinase activity and regulate fatty acid metabolism. It is commonly used in research studies involving insulin signaling pathways and the modulation of cellular processes. Additionally, this antibody has been investigated for its potential therapeutic applications in various fields, including the treatment of mesenchymal stem cells and the development of novel oral contraceptives. Its high specificity and effectiveness make it a valuable tool for researchers in the Life Sciences field.</p>

<p>PSMD3 antibody was raised using a synthetic peptide corresponding to a region with amino acids RLNHYVLYKAVQGFFTSNNATRDFLLPFLEEPMDTEADLQFRPRTGKAAS</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of MAP2K2 antibody, catalog no. 70R-2007</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of CPXCR1 antibody, catalog no. 20R-1231</p>

<p>DARS antibody was raised in Rabbit using Human DARS as the immunogen</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of IGSF8 antibody, catalog no. 70R-9919</p>

<p>Purified Avidin protein (Texas Red) from hen egg white</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of JAK3 antibody, catalog no. 70R-5747</p>

<p>Sheep polyclonal DNM1 antibody (Ser778)</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of ALX3 antibody, catalog no. 20R-1182</p>

<p>The NME1 protein is an antigen that belongs to the group of Recombinant Proteins &amp; Antigens. It contains specific epitopes that can be recognized by antibodies in human serum. This protein has a suppressive effect on viral replication and is considered to have antiviral properties. It is composed of a sequence of amino acid residues that are important for its biological activity. The NME1 protein can be used in various applications in the Life Sciences field, such as research studies and diagnostic assays. Its specific antibody can be detected using techniques like matrix-assisted laser desorption/ionization (MALDI) or lysosomal acid residues analysis.</p>

<p>Rabbit polyclonal HEY2 antibody</p>

<p>The ZIP7 antibody is a powerful tool in the field of life sciences. It is a polyclonal antibody that specifically targets and binds to ZIP7, a protein involved in various cellular processes. This antibody can be used for research purposes to study the role of ZIP7 in different signaling pathways, such as TGF-beta and interferon signaling. Additionally, the ZIP7 antibody can be utilized in experiments to detect and measure the levels of ZIP7 protein in samples, including human serum or cell lysates. Its high specificity and affinity make it an essential tool for scientists studying growth factors, binding proteins, and tyrosine phosphatases. Whether you are investigating cellular mechanisms or developing therapeutic interventions, the ZIP7 antibody is an indispensable asset for your research endeavors.</p>

<p>Rabbit polyclonal ZBED1 antibody (biotin)</p>

<p>Rabbit polyclonal TF2H2 antibody</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of MGST1 antibody, catalog no. 70R-10041</p>

<p>Cytokeratin 222 Pseudogene antibody was raised using the N terminal of KRT222P corresponding to a region with amino acids ELSQLLNEIRANYEKILTRNQIETVLSTRIQLEEDISKKMDKDEEALKAA</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of SLC39A9 antibody, catalog no. 70R-6753</p>

<p>CD248 antibody was raised in Rabbit using Human CD248 as the immunogen</p>

<p>Purified Rabbit IgG (Fab'2)</p>

<p>A2M antibody was raised in Rabbit using Human A2M as the immunogen</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of RHOU antibody, catalog no. 70R-5757</p>

<p>The Tau antibody is a medicament that belongs to the class of globulin-based drugs. It is a polyclonal antibody that has been specifically designed to target and neutralize the activity of Tau protein. Tau protein plays a crucial role in the pathogenesis of neurodegenerative diseases, such as Alzheimer's disease, by forming abnormal aggregates in the brain.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of CD36 antibody, catalog no. 70R-6104</p>

<p>DGUOK antibody was raised in Rabbit using Human DGUOK as the immunogen</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of KIF5A antibody, catalog no. 70R-2074</p>

<p>Rabbit polyclonal BTBD6 antibody</p>

<p>Rabbit polyclonal p62 DOK antibody</p>

<p>The UBE2T antibody is a highly specialized product used in the field of Life Sciences. It is a polyclonal antibody that specifically targets UBE2T, a protein involved in various cellular processes. This antibody has been extensively tested and validated for its specificity and sensitivity.</p>

<p>Rabbit polyclonal PRPH antibody</p>

<p>Purified Polyclonal NKX21 antibody</p>

<p>The GPR151 antibody is a highly specialized monoclonal antibody that is used in the field of Life Sciences. It targets the p38 mitogen-activated protein phosphatase, which plays a crucial role in various cellular processes such as growth factor signaling and β-catenin activation. This antibody specifically recognizes and binds to the activated form of the p38 MAP phosphatase, allowing for its detection and analysis.</p>

<p>Rabbit polyclonal EPHB2 antibody (Tyr317)</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of GLIPR1L1 antibody, catalog no. 70R-4567</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of RANBP5 antibody, catalog no. 70R-9233</p>

<p>SAA antibody is a monoclonal antibody that specifically targets serum amyloid A (SAA), a glycoprotein involved in the immune response and inflammation. This antibody has been extensively studied in the field of life sciences and has shown promising results in various applications. SAA antibody can be used for the detection and quantification of SAA levels, making it a valuable tool in research and diagnostic settings. Additionally, this monoclonal antibody has been used to study the role of SAA in diseases such as cancer, cardiovascular disorders, and autoimmune conditions. Its high specificity and affinity make it an ideal choice for experiments involving SAA, providing accurate and reliable results. With its ability to bind to SAA with precision, this antibody opens up new possibilities for understanding the mechanisms underlying these diseases and developing targeted therapies. Whether you're conducting cutting-edge research or working on diagnostic assays, SAA antibody is an indispensable tool that will help advance your scientific endeavors.</p>

<p>TOB1 antibody was raised in rabbit using the middle region of TOB1 as the immunogen</p>

<p>Region of FGF17 protein corresponding to amino acids MTQGENHPSP NFNQYVRDQG AMTDQLSRRQ IREYQLYSRT SGKHVQVTGR RISATAEDGN KFAKLIVETD TFGSRVRIKG AESEKYICMN KRGKLIGKPS GKSKDCVFTE IVLENNYTAF QNARHEGWFM AFTRQGRPRQ ASRSRQNQRE AHFIKRLYQG QLPFPNHAEK QKQFEFVGSA PTRRTKRTRR PQPLT.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of LARP7 antibody, catalog no. 70R-1451</p>

<p>ACSL1 antibody was raised in Rabbit using Human ACSL1 as the immunogen</p>

<p>NAV2 antibody was raised in Rabbit using Human NAV2 as the immunogen</p>

<p>Rabbit Polyclonal Gab1 antibody (Tyr627)</p>

<p>FBXO16 antibody was raised using the N terminal of FBXO16 corresponding to a region with amino acids CRKLQEKIPAEALDFTTKLPRVLSLYIFSFLDPRSLCRCAQVCWHWKNLA</p>

<p>The NOD1 antibody is a highly sensitive detection tool used in immunoassays. It belongs to the family of antibodies used in Life Sciences research. This polyclonal antibody is specifically activated against amyloid plaque, making it an ideal tool for studying and detecting this protein in various biological samples. The NOD1 antibody can be utilized in a range of applications, including DNA vaccines, carbon electrode bioassays, and immunoassays targeting amyloid proteins. It is available both as a polyclonal and monoclonal antibody, ensuring flexibility for different experimental needs. With its high specificity and sensitivity, the NOD1 antibody is commonly used for detecting anti-beta amyloid antibodies in human serum or alpha-fetoprotein in various clinical and research settings.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of C14orf133 antibody, catalog no. 70R-3631</p>

<p>1-501 amino acids: MSSSGTPDLP VLLTDLKIQY TKIFINNEWH DSVSGKKFPV FNPATEEELC QVEEGDKEDV DKAVKAARQA FQIGSPWRTM DASERGRLLY KLADLIERDR LLLATMESMN GGKLYSNAYL NDLAGCIKTL RYCAGWADKI QGRTIPIDGN FFTYTRHEPI GVCGQIIPWN FPLVMLIWKI GPALSCGNTV VVKPAEQTPL TALHVASLIK EAGFPPGVVN IVPGYGPTAG AAISSHMDID KVAFTGSTEV GKLIKEAAGK SNLKRVTLEL GGKSPCIVLA DADLDNAVEF AHHGVFYHQG QCCIAASRIF VEESIYDEFV RRSVERAKKY ILGNPLTPGV TQGPQIDKEQ YDKILDLIES GKKEGAKLEC GGGPWGNKGY FVQPTVFSNV TDEMRIAKEE IFGPVQQIMK FKSLDDVIKR ANNTFYGLSA GVFTKDIDKA ITISSALQAG TVWVNCYGVV SAQCPFGGFK MSGNGRELGE YGFHEYTEVK TVTVKISQKN S</p>

<p>Recombinant human ARL15 protein (His tag)</p>

<p>HEATR4 antibody was raised using the N terminal of HEATR4 corresponding to a region with amino acids VFFSSQYRLHRKSQYLKMAAANLTFSQEVVWQRGLPSIPYSQYSFDHLYN</p>

<p>Affinity purified Rabbit polyclonal UGT1A9 antibody</p>

<p>NEFL antibody was raised in Rabbit using Human NEFL as the immunogen</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of IMMP2L antibody, catalog no. 70R-10109</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of TMED4 antibody, catalog no. 70R-7109</p>

<p>Rabbit polyclonal APOL2 antibody</p>

<p>Gemin 2 Monoclonal Antibody</p>

<p>HBsAg antibody (biotin) was raised in goat using subtypes ad &amp; ay as the immunogen.</p>

<p>Affinity purified Rabbit polyclonal PRNP antibody</p>

<p>Purified recombinant Human BPHL protein</p>

<p>Rabbit polyclonal PKC theta antibody</p>

<p>The BIM antibody is a monoclonal antibody that specifically targets c-myc, a protein involved in various cellular processes. This antibody is widely used in Life Sciences research to study the function and regulation of c-myc. It can be used in techniques such as immunohistochemistry, immunofluorescence, and Western blotting to detect the presence of c-myc in different samples.</p>

<p>KCTD3 antibody was raised using the middle region of KCTD3 corresponding to a region with amino acids VNKSEDKDVGGPTEEELLKLLDQCDLSTSRCATPNISPATSVVQHSHLRE</p>

<p>Tyk2 antibody was raised in Mouse using a purified recombinant fragment of Tyk2 expressed in E. coli as the immunogen.</p>

<p>Purified recombinant E.coli melA Protein (His tag)</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of RBM34 antibody, catalog no. 70R-4948</p>

<p>C13orf30 antibody was raised using the N terminal of C13orf30 corresponding to a region with amino acids MGQNWKRQQKLWNVPQLPFIRVPPSIYDTSLLKALNQGQQRYFYSIMRIY</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of LIN7C antibody, catalog no. 70R-2578</p>

<p>APOF antibody was raised in Rabbit using Human APOF as the immunogen</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of Apof antibody, catalog no. 70R-8522</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of CSK antibody, catalog no. 70R-3659</p>

<p>BTK antibody was raised in Mouse using a purified recombinant fragment of BTK expressed in E. coli as the immunogen.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of MAOB antibody, catalog no. 70R-6478</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of C3orf10 antibody, catalog no. 70R-1299</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of OGDHL antibody, catalog no. 70R-9480</p>

<p>Rabbit polyclonal BRSK1 antibody</p>

<p>Purified IgG protein (Human) (Fab'2)</p>

<p>18-248 amino acids: MEELPAPVKA IEKQGITIIK TFDAPGGMKG YLGKYQDMGV TIYLTPDGKH AISGYMYNEK GENLSNTLIE KEIYAPAGRE MWQRMEQSHW LLDGKKDAPV IVYVFADPFC PYCKQFWQQA RPWVDSGKVQ LRTLLVGVIK PESPATAAAI LASKDPAKTW QQYEASGGKL KLNVPANVST EQMKVLSDNE KLMDDLGANV TPAIYYMSKE NTLQQAVGLP DQKTLNIIMG NK</p>

<p>HSV1 antibody (FITC) was raised in goat using HSV type 1, strain F as the immunogen.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of CASD1 antibody, catalog no. 70R-7436</p>

<p>The IL2R alpha protein is a crucial component in Life Sciences research. It plays a vital role in immune response activation and regulation. This protein can be activated by the binding of specific antibodies, forming an antibody complex that aids in the identification and targeting of various pathogens, including cryptosporidium.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of C6orf134 antibody, catalog no. 70R-1282</p>

<p>DCP1B antibody was raised in Rabbit using Human DCP1B as the immunogen</p>

<p>ARHGAP20 antibody was raised in rabbit using the middle region of ARHGAP20 as the immunogen</p>

<p>Rabbit polyclonal BRCA1 antibody (biotin)</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of TNNI3K antibody, catalog no. 70R-3960</p>

<p>Rabbit polyclonal MAPKAPK2 antibody (Ser272)</p>

<p>Purified Polyclonal PTGR2 antibody</p>

<p>Rabbit polyclonal IKK alpha/beta antibody for detection of the Phospho-Ser176 form of the IKK alpha/beta peptide.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of CNTNAP4 antibody, catalog no. 70R-6128</p>

<p>Rabbit Polyclonal NFkB p105/p50 antibody (Ser927)</p>

<p>Rabbit polyclonal PSMB10 antibody</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of RAB11FIP2 antibody, catalog no. 70R-4509</p>

<p>Clns1a antibody was raised in rabbit using the C terminal of Clns1a as the immunogen</p>

<p>Human IgE Myeloma, Kappa Protein</p>

<p>FBXL20 antibody was raised in rabbit using the middle region of FBXL20 as the immunogen</p>

<p>Mouse monoclonal IgG2a kappa Isotype Control Fc fusion protein</p>

<p>The AKR1C2 antibody is a highly specialized protein that plays a crucial role in various biological processes. It has been extensively studied in the field of Life Sciences and has shown significant potential in research and therapeutic applications.</p>

<p>The STK24 antibody is a polyclonal antibody that is highly effective in targeting and neutralizing cytotoxic factors in various biological samples, including pleural fluid, human serum, and tissue culture media. This antibody specifically binds to STK24, a protein kinase involved in the regulation of cell growth and survival. By binding to STK24, this antibody inhibits its activity and prevents the downstream signaling pathways that promote cell proliferation and survival.</p>

<p>Rabbit polyclonal CRHR1 antibody</p>

<p>GPRASP2 antibody was raised using the middle region of GPRASP2 corresponding to a region with amino acids EQESLLQPDQPSPEFTFQYDPSYRSVREIREHLRARESAESESWSCSCIQ</p>

<p>The ATXN1 antibody is a highly reactive and neutralizing polyclonal antibody that specifically targets the ATXN1 protein. This protein is involved in various cellular processes, including cell signaling and gene expression regulation. The ATXN1 antibody has been shown to be effective in blocking the activity of ATXN1, making it an ideal tool for studying its function and potential therapeutic applications. It can also be used as a diagnostic tool to detect the presence of autoantibodies against ATXN1 in human serum. The ATXN1 antibody is produced using advanced techniques and quality control measures to ensure its purity and specificity. With its high affinity and selectivity, this monoclonal antibody provides reliable results in various research settings.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of BCAS2 antibody, catalog no. 70R-5000</p>

<p>Fto antibody was raised in rabbit using the N terminal of Fto as the immunogen</p>

<p>E7 antibody was raised in Mouse using a purified recombinant fragment of E7 expressed in E. coli as the immunogen.</p>

<p>Rabbit polyclonal FOXI1 antibody</p>

<p>DGCR8 antibody was raised in Rabbit using Human DGCR8 as the immunogen</p>

<p>Rabbit polyclonal IKK beta antibody</p>

<p>Affinity purified Rabbit polyclonal HSPE1 antibody</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of YTHDF3 antibody, catalog no. 70R-3209</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of INTS6 antibody, catalog no. 70R-4691</p>

<p>ENTPD6 antibody was raised in Rabbit using Human ENTPD6 as the immunogen</p>

<p>Affinity purified Rabbit polyclonal Histone H2A.Z antibody</p>

<p>The Cytokeratin 20 antibody is a highly specific polyclonal antibody that targets the CD3 receptor. It can be used in various applications such as immunohistochemistry and flow cytometry. This antibody is reactive against alpha-fetoprotein and has been shown to have neutralizing properties. It can be used as a diagnostic reagent in the detection of certain diseases or conditions. The Cytokeratin 20 antibody is also useful in research settings for studying TGF-beta signaling, collagen synthesis, and other related processes. With its high specificity and versatility, this monoclonal antibody is a valuable tool for researchers and clinicians alike.</p>

<p>PAGE4 antibody was raised using a synthetic peptide corresponding to a region with amino acids PPIEERKVEGDCQEMDLEKTRSERGDGSDVKEKTPPNPKHAKTKEAGDGQ</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of FNDC3B antibody, catalog no. 70R-1835</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of MCART6 antibody, catalog no. 70R-6765</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of NOG antibody, catalog no. 70R-4585</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of Gns antibody, catalog no. 70R-8622</p>

<p>PLP2 antibody was raised using a synthetic peptide corresponding to a region with amino acids LVERGNHSKIVAGVLGLIATCLFGYDAYVTFPVRQPRHTAAPTDPADGPV</p>

<p>Rabbit polyclonal AHSA1 antibody (FITC)</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of 2610034B18Rik antibody, catalog no. 70R-9356</p>

<p>Rabbit polyclonal SNX3 antibody</p>

<p>Purified recombinant Human RhoD protein</p>

<p>Streptavidin Poly-HRP40 Conjugate, supplied as 10 ug/ml in Streptavidin-Poly-HRP Stabilizer 85R-112. For use in immunoassays.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of SFTPC antibody, catalog no. 70R-7062</p>

<p>The TCTP antibody is a biochemical agent that targets the hyperpolarization-activated protein kinase. It belongs to the group of polyclonal antibodies and can be used for various applications, including research and diagnostic purposes. This antibody specifically recognizes TCTP (Translationally Controlled Tumor Protein), which has been found to play a role in various cellular processes such as cell growth, proliferation, and apoptosis.</p>

<p>Purified Polyclonal Opticin antibody</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of Adam22 antibody, catalog no. 70R-8650</p>

<p>CCDC56 antibody was raised in Rabbit using Human CCDC56 as the immunogen</p>

<p>The MKK6 antibody is a monoclonal antibody that has inhibitory properties against the MKK6 protein. It is commonly used in Life Sciences research to study the role of MKK6 in various cellular processes. This antibody specifically binds to the MKK6 protein and neutralizes its activity, allowing researchers to investigate its function and signaling pathways. The MKK6 antibody has been extensively tested in vitro using liver microsomes and has shown high specificity and affinity for the target protein. It is suitable for use in a wide range of applications, including Western blotting, immunohistochemistry, and enzyme-linked immunosorbent assays (ELISA). This product is supplied with all necessary excipients for stability and can be stored at recommended temperatures for long-term use. Researchers interested in studying the effects of MKK6 on cellular growth, differentiation, or response to growth factors such as epidermal growth factor or insulin may find this antibody particularly useful. Additionally, it has been shown to have</p>