Biochemicals and Reagents

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of VPS53 antibody, catalog no. 70R-3481</p>

<p>Mouse monoclonal HHEX antibody</p>

<p>Purified recombinant Human CUL1 protein</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of CTAG1B antibody, catalog no. 70R-10169</p>

<p>The CPA1 antibody is a highly specific monoclonal antibody that targets collagen. It is commonly used in the field of Life Sciences for various applications. This antibody can be used to detect the presence of collagen in samples, making it a valuable tool for research and diagnostic purposes. The CPA1 antibody has been extensively tested and validated, ensuring its reliability and accuracy.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of COX7B antibody, catalog no. 70R-4528</p>

<p>WDR21A antibody was raised using the middle region of WDR21A corresponding to a region with amino acids GHRQSFGTNSDVLAQQFALMAPLLFNGCRSGEIFAIDLRCGNQGKGWKAT</p>

<p>Mouse monoclonal TTLL12 antibody</p>

<p>The NMDAR1 antibody is a monoclonal antibody that targets the N-methyl-D-aspartate receptor subtype 1 (NMDAR1). This receptor is involved in various physiological processes, including synaptic plasticity and learning. The NMDAR1 antibody has been shown to inhibit the activation of NMDAR1 and reduce microvessel density in tumors by blocking the binding of growth factors to their receptors. It has also been demonstrated to modulate the expression of histidine, epidermal growth factor, and steroid receptors in granulosa cells. In addition, this antibody can activate e-cadherin and β-catenin signaling pathways, which are important for cell adhesion and migration. Overall, the NMDAR1 antibody offers promising applications in life sciences research and provides valuable insights into cellular mechanisms related to growth and development.</p>

<p>Rabbit polyclonal NOP2 antibody</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of CENPM antibody, catalog no. 70R-2295</p>

<p>ZPLD1 antibody was raised using the C terminal of ZPLD1 corresponding to a region with amino acids DAGRRTTWSPQSSSGSAVLSAGPIITRSDETPTNNSQLGSPSMPPFQLNA</p>

<p>Purified recombinant Human SUMO3 protein</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of FLJ11171 antibody, catalog no. 70R-3874</p>

<p>ACTR3B antibody was raised in Rabbit using Human ACTR3B as the immunogen</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of LEMD2 antibody, catalog no. 70R-6307</p>

<p>RIPK5 antibody was raised using the middle region of RIPK5 corresponding to a region with amino acids EECWQLMEACWDGDPLKRPLLGIVQPMLQGIMNRLCKSNSEQPNRGLDDS</p>

<p>Purified Polyclonal RAB2B antibody</p>

<p>PRLHR antibody was raised in rabbit using a synthetic peptide conjugated to KLH as the immunogen.</p>

<p>RABEPK antibody was raised using the N terminal of RABEPK corresponding to a region with amino acids MKQLPVLEPGDKPRKATWYTLTVPGDSPCARVGHSCSYLPPVGNAKRGKV</p>

<p>Purified Polyclonal Dishevelled 3 antibody</p>

HAX1 antibody was raised using the middle region of HAX1 corresponding to a region with amino acids LPGPESETPGERLREGQTLRDSMLKYPDSHQPRIFGGVLESDARSESPQP

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of CES1 antibody, catalog no. 70R-1213</p>

<p>Goat anti-Human IgA (alpha chain) (FITC) was raised in goat using purified Human IgA as the immunogen.</p>

<p>Rabbit polyclonal NDUFA3 antibody</p>

<p>Mouse monoclonal TTLL12 antibody</p>

<p>HNRNPC antibody was raised using a synthetic peptide corresponding to a region with amino acids ESEGGADDSAEEGDLLDDDDNEDRGDDQLELIKDDEKEAEEGEDDRDSAN</p>

<p>EIF6 antibody was raised in Rabbit using Human EIF6 as the immunogen</p>

<p>Rabbit polyclonal SGK antibody (Ser422)</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of SHMT2 antibody, catalog no. 70R-1287</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of KCNJ1 antibody, catalog no. 70R-5144</p>

<p>The Caspase 3 antibody is a highly effective and cytotoxic medicament used in the field of Life Sciences. This antibody, available in both polyclonal and monoclonal forms, is specifically designed to target and neutralize activated caspase 3 proteins. By binding to these proteins, the Caspase 3 antibody effectively inhibits their activity, preventing cell death and promoting cell survival.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of SPZ1 antibody, catalog no. 20R-1158</p>

<p>ELOVL4 antibody was raised in Rabbit using Human ELOVL4 as the immunogen</p>

<p>The NGAL antibody is a highly specialized monoclonal antibody that has been extensively studied in the field of Life Sciences. It is an 8-substituted antibody that exhibits glycosylation, making it highly effective in targeting specific molecules and proteins within the body. The NGAL antibody has shown promising results in inhibiting interleukin-6, a key growth factor involved in various inflammatory processes. Additionally, this antibody has demonstrated its efficacy in neutralizing antibodies such as erythropoietin and epidermal growth factor, which play crucial roles in certain diseases. The NGAL antibody's unique structure allows it to bind specifically to tyrosine residues on target molecules, enabling precise targeting and modulation of cellular functions. Its binding affinity has been proven through rigorous laboratory testing using state-of-the-art electrode techniques. In recent studies, the NGAL antibody has shown potential therapeutic effects against Helicobacter pylori infection, a bacteria known for causing gastric ulcers and other gastrointestinal disorders. Furthermore, this</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of NOB1 antibody, catalog no. 70R-3402</p>

<p>The CDKL5 antibody is a highly specialized monoclonal antibody used in Life Sciences research. It specifically targets the CDKL5 protein, which plays a crucial role in various cellular processes. The antibody works by binding to the CDKL5 protein and inhibiting its activity, allowing researchers to study its function and potential therapeutic applications.</p>

<p>Mouse monoclonal CD28 antibody (PE); target rat</p>

<p>SIGLEC10 antibody was raised using the middle region of SIGLEC10 corresponding to a region with amino acids CHVDFSRKGVSAQRTVRLRVAYAPRDLVISISRDNTPALEPQPQGNVPYL</p>

<p>The beta Catenin antibody is a powerful tool used in life sciences research. It is a polyclonal antibody that specifically targets and detects activated nuclear β-catenin, a critical protein involved in various cellular processes. This antibody has been extensively validated for its high specificity and sensitivity.</p>

<p>Heroin Conjugate for use in immunoassays</p>

<p>Purified native Influenza A H3N2 protein (Panama)</p>

<p>alpha 2 Antiplasmin antibody was raised in goat using human alpha 2 Antiplasmin purified from plasma as the immunogen.</p>

<p>The TIMP2 antibody is a monoclonal antibody that plays a crucial role in neutralizing interferon. It is widely used in the field of Life Sciences and has shown promising results in various applications. This antibody specifically targets adipose tissue and has been found to have potential therapeutic effects in diseases related to adiponectin, such as obesity and diabetes.</p>

<p>Region of RELM alpha protein corresponding to amino acids MDETIEIIVE NKVKELLANP ANYPSTVTKT LSCTSVKTMN RWASCPAGMT ATGCACGFAC GSWEIQSGDT CNCLCLLVDW TTARCCQLS.</p>

<p>The Leptin Receptor antibody is a highly specialized monoclonal antibody that is designed to target and neutralize the leptin receptor in human serum. Leptin receptor plays a crucial role in regulating various physiological processes such as metabolism, appetite, and energy balance. This antibody specifically binds to the leptin receptor and inhibits its activity, thereby modulating the signaling pathways associated with it.</p>

<p>CYP2A7 antibody was raised using the middle region of CYP2A7 corresponding to a region with amino acids KVEHNQRTLDPNSPQDFIDSFLIHMQEEEKNPNTEFYLKNLMMSTLNLFI</p>

<p>Donkey anti-rabbit IgG (H+L) (Rhodamine) was raised in donkey using rabbit IgG whole molecule as the immunogen.</p>

<p>Affinity purified Rabbit polyclonal VPS11 antibody</p>

<p>PSMA4 antibody was raised using a synthetic peptide corresponding to a region with amino acids PCEQLVTALCDIKQAYTQFGGKRPFGVSLLYIGWDKHYGFQLYQSDPSGN</p>

<p>Rabbit polyclonal cJun antibody</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of ZNF676 antibody, catalog no. 70R-8867</p>

<p>Rabbit polyclonal HSPA13 antibody (biotin)</p>

<p>Purified recombinant Human CETN3 protein</p>

<p>The Bub1 Antibody is a highly effective monoclonal antibody that is widely used in Life Sciences research. It is specifically designed to target and neutralize the protein kinase activity of Bub1, a key regulator of the cell cycle. This antibody has been shown to inhibit the phosphorylation of downstream targets, such as p38 MAPK, and interfere with cell growth and proliferation. Additionally, it has been demonstrated to block the activation of phosphatases and reduce the levels of interleukin-6, an important pro-inflammatory cytokine. With its high specificity and potency, the Bub1 Antibody is an essential tool for studying cell signaling pathways and understanding their role in various biological processes.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of PHF19 antibody, catalog no. 70R-8879</p>

<p>Rabbit Polyclonal Rb antibody (Ser807)</p>

<p>PHYH antibody was raised using the middle region of PHYH corresponding to a region with amino acids EKGDTVFFHPLLIHGSGQNKTQGFRKAISCHFASADCHYIDVKGTSQENI</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of ADAM12 antibody, catalog no. 70R-6059</p>

<p>Rabbit polyclonal ACVL1 antibody</p>

<p>The COL3A1 antibody is a polyclonal antibody that is widely used in Life Sciences research. It specifically targets the COL3A1 gene, which encodes for the collagen type III alpha 1 chain protein. This protein is predominantly found in cardiomyocytes and plays a crucial role in maintaining the structural integrity of the heart. The COL3A1 antibody has been extensively tested and validated for its specificity and sensitivity. It has shown excellent performance in various applications, including Western blotting, immunohistochemistry, and ELISA assays. In addition to its high affinity for the target protein, this antibody also exhibits minimal cross-reactivity with other proteins commonly found in human serum or albumin. This ensures accurate and reliable results in experiments involving complex biological samples. Researchers have also reported successful use of the COL3A1 antibody in combination with other antibodies, such as anti-CD20 antibodies or protein kinase inhibitors. This allows for more comprehensive studies on signaling pathways or cellular interactions involving COL3</p>

<p>EXT2 antibody was raised in Rabbit using Human EXT2 as the immunogen</p>

<p>PSMB5 antibody was raised using a synthetic peptide corresponding to a region with amino acids IVAADSRATAGAYIASQTVKKVIEINPYLLGTMAGGAADCSFWERLLARQ</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of SOX4 antibody, catalog no. 70R-8248</p>

<p>Affinity purified Rabbit polyclonal FBXO43 antibody</p>

<p>The CDC42 antibody is a highly specialized antibody that targets the protein CDC42. This protein plays a crucial role in various cellular processes, including cell growth, division, and movement. The CDC42 antibody is designed to bind specifically to CDC42, thereby neutralizing its activity.</p>

<p>HCG antibody was raised against Human hCG (intact).</p>

<p>FILIP1L antibody was raised using the middle region of FILIP1L corresponding to a region with amino acids KSLRPSLNGRRISDPQVFSKEVQTEAVDNEPPDYKSLIPLERAVINGQLY</p>

<p>CTNND1 antibody was raised in Rabbit using Human CTNND1 as the immunogen</p>

<p>AMBRA1 antibody was raised in Rabbit using Human AMBRA1 as the immunogen</p>

<p>CRISPR/Cas9 Monoclonal Antibody (HRP)</p>

<p>The ABCA1 antibody is a neuroprotective monoclonal antibody that plays a crucial role in the field of Life Sciences. It is widely used in research and medical applications to study the function and regulation of ABCA1, a key protein involved in lipid metabolism and cholesterol efflux. This antibody specifically targets ABCA1 and inhibits its proteolytic activity, preventing the degradation of this important protein.</p>

<p>The ATOH1 protein is a crucial component in the field of Life Sciences and is widely used in research and development. It is commonly utilized as an antibody, recombinant protein, and antigen for various applications. The ATOH1 protein plays a significant role in the regulation of cell differentiation, particularly in mesenchymal stem cells.</p>

<p>ITGB3BP antibody was raised using a synthetic peptide corresponding to a region with amino acids TGTCQMSLFASPTSSEEQKHRNGLSNEKRKKLNHPSLTESKESTTKDNDE</p>

<p>The SAMHD1 antibody is a highly specialized product in the field of Life Sciences. It is a monoclonal antibody that has been developed for use in various research applications. The antibody can be used for particle chemiluminescence assays to detect the presence and activity of SAMHD1 protein. It has been shown to have high specificity and sensitivity, making it an ideal tool for studying this important protein.</p>

<p>The PDGFRB antibody is an active agent that plays a crucial role in various biological processes. It is an autoantibody that can be used as a medicine to target specific cells or molecules in the body. This antibody has been shown to regulate the interferon-stimulated gene and modulate the release of neurotransmitters such as acetylcholine and dopamine. Additionally, it has been found to have pluripotent stem cell properties, making it valuable in regenerative medicine research.</p>

<p>WDR13 antibody was raised using the N terminal of WDR13 corresponding to a region with amino acids GQRYGPLSEPGSARAYSNSIVRSSRTTLDRMEDFEDDPRALGARGHRRSV</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of STOML3 antibody, catalog no. 70R-7077</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of ANKRD7 antibody, catalog no. 70R-3764</p>

<p>NGAL antibody is a monoclonal antibody that specifically targets neutrophil gelatinase-associated lipocalin (NGAL). NGAL is a protein that plays a crucial role in various biological processes, including the regulation of epidermal growth factor and fatty acid metabolism. This antibody is widely used in Life Sciences research, particularly in the field of Antibodies and colloidal studies. It has been shown to inhibit the activity of growth factors such as anti-CD33 antibody and chemokines, as well as cytokines like interleukin-6. NGAL antibody is also used in the study of mesenchymal stem cells and their differentiation processes. Its high specificity and low viscosity make it an ideal tool for researchers studying NGAL-related pathways and developing inhibitors for therapeutic purposes.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of DOK5 antibody, catalog no. 70R-3341</p>

<p>Mouse monoclonal Reticulon 1A/B antibody</p>

<p>Goat anti-rabbit IgG (Alk Phos) was raised in goat using rabbit IgG F(c) fragment as the immunogen.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of MFRP antibody, catalog no. 70R-6476</p>

<p>LYVE1 antibody was raised in rabbit using recombinant mouse soluble Lyve-1 as the immunogen.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of TNPO2 antibody, catalog no. 70R-2016</p>

<p>VEGFB antibody was raised in rabbit using the middle region of VEGFB as the immunogen</p>

<p>DNMBP antibody was raised in Rabbit using Human DNMBP as the immunogen</p>

<p>1-114 amino acids: MTCKMSQLER NIETIINTFH QYSVKLGHPD TLNQGEFKEL VRKDLQNFLK KENKNEKVIE HIMEDLDTNA DKQLSFEEFI MLMARLTWAS HEKMHEGDEG PGHHHKPGLG EGTPLEHHHH HH</p>

<p>The Tau antibody is a highly specialized protein that plays a crucial role in the field of Life Sciences. It is widely used for ultrasensitive detection and analysis of protein carbonyls, particularly in human serum samples. This antibody has been extensively studied and proven to be effective in detecting and neutralizing fibrinogen, a key protein involved in blood clotting.</p>

<p>The C-Fos antibody is a highly specialized monoclonal antibody used in Life Sciences research. It specifically targets the protein c-Fos, which is involved in various cellular processes such as cell growth and differentiation. This antibody recognizes the amino group of c-Fos and can be used for applications such as immunohistochemistry, western blotting, and ELISA.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of ERLIN2 antibody, catalog no. 70R-5388</p>

<p>Purified Polyclonal Renin Receptor antibody</p>

<p>Rabbit polyclonal LSHR antibody</p>

<p>The HDAC2 antibody is a monoclonal antibody used in Life Sciences research. It is designed to target and bind to histone deacetylase 2 (HDAC2), an enzyme involved in the regulation of gene expression. This antibody can be used in various applications, including immunohistochemistry, western blotting, and flow cytometry.</p>

<p>Rabbit polyclonal MAP1S antibody</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of TMED4 antibody, catalog no. 70R-1481</p>

<p>Mouse monoclonal LIPG antibody</p>

<p>The Glutamate receptor 2 antibody is a highly reactive monoclonal antibody that is used in life sciences research. It specifically targets the glutamate receptors present in various protein isoforms. The antibody works by binding to the receptors and disrupting protein-protein interactions, thus inhibiting the activation of colony-stimulating factors. This leads to a reduction in cytotoxic effects and promotes the pluripotency of cells. The Glutamate receptor 2 antibody is produced using recombinant vaccinia technology, ensuring high purity and specificity. Additionally, it forms a stable disulfide bond with its target, resulting in long-lasting and reliable results. Researchers can rely on this monoclonal antibody for accurate detection and analysis of β-catenin signaling pathways.</p>

<p>TMCO4 antibody was raised in rabbit using the C terminal of TMCO4 as the immunogen</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of UGT2A3 antibody, catalog no. 70R-7206</p>

<p>Sheep polyclonal Lasalocid antibody</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of PLS3 antibody, catalog no. 70R-3756</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of TMEM168 antibody, catalog no. 70R-6246</p>

<p>Rabbit polyclonal TOMM22 antibody</p>

<p>Rabbit polyclonal RTP1 antibody</p>

<p>The GLUT4 antibody is a monoclonal antibody that plays a crucial role in glucose absorption and sugar metabolism. It specifically targets the insulin-regulated aminopeptidase, which is responsible for the transportation of glucose into adipose tissue. By binding to this target, the GLUT4 antibody enhances glucose uptake and promotes its storage as glycogen.</p>

<p>Rabbit Polyclonal Synuclein antibody (Ser129)</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of PDZK1 antibody, catalog no. 70R-3097</p>

<p>This antibody reacts with heavy chains on Guinea Pig IgG and light chains on all Guinea Pig immunoglobulins.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of DDB2 antibody, catalog no. 70R-10002</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of UBE2C antibody, catalog no. 70R-5585</p>

<p>Rabbit Polyclonal OR8H3 antibody</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of EXOC5 antibody, catalog no. 70R-3820</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of PHACTR3 antibody, catalog no. 70R-2298</p>

<p>Mouse monoclonal LDLRAP1 antibody</p>

<p>Rabbit polyclonal SRF antibody (Ser99)</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of CYP2B6 antibody, catalog no. 70R-5412</p>

<p>PIP5KL1 antibody was raised using the middle region of PIP5KL1 corresponding to a region with amino acids VLDYSLLIAFQRLHEDERGPGSSLIFRTARSVQGAQSPEESRAQNRRLLP</p>

<p>The p53 antibody is a monoclonal antibody that is used for immunohistochemical detection. It specifically targets the p53 protein, which plays a crucial role in regulating cell growth and preventing tumor formation. The p53 antibody binds to the tetramerization domain of the p53 protein, allowing for its detection in various tissues and cells. This antibody has been widely used in research and diagnostic applications to study the expression and localization of p53 in different diseases, including cancer. Its high specificity and sensitivity make it a valuable tool for understanding the molecular mechanisms underlying tumor development and progression.</p>

<p>Fresh tissue lysate isolated from the striatum of human brain</p>

<p>RAD23A antibody was raised using a synthetic peptide corresponding to a region with amino acids  VPSSGSSGREEDAASTLVTGSEYETMLTEIMSMGYERERVVAALRASYNN</p>

<p>PPFIBP1 antibody was raised using a synthetic peptide corresponding to a region with amino acids PFMGSLRALHLVEDLRGLLEMMETDEKEGLRCQIPDSTAETLVEWLQSQM</p>

<p>Scfd2 antibody was raised in rabbit using the middle region of Scfd2 as the immunogen</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of CYP2A7 antibody, catalog no. 70R-7501</p>

<p>Delta Catenin antibody was raised in Guinea Pig using synthetic peptide J7 coupled to KLH as the immunogen.</p>

<p>Human RBC antibody was raised in rabbit using human erythrocytes as the immunogen.</p>

<p>Mouse monoclonal RfbE antibody</p>

<p>Mouse monoclonal DLD antibody</p>

<p>KDM5A antibody was raised in Rabbit using Human KDM5A as the immunogen</p>

<p>PRAME antibody was raised using the N terminal of PRAME corresponding to a region with amino acids AMVQAWPFTCLPLGVLMKGQHLHLETFKAVLDGLDVLLAQEVRPRRWKLQ</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of ACTR2 antibody, catalog no. 70R-1197</p>

<p>CLPS antibody was raised in Rabbit using Human CLPS as the immunogen</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of P2RX7 antibody, catalog no. 70R-5097</p>

<p>The PKR antibody is a highly effective tool used in Life Sciences research. It is available as both polyclonal and monoclonal antibodies, providing researchers with multiple options for their experiments. This antibody specifically targets the protein kinase RNA-activated (PKR) enzyme, which plays a crucial role in regulating cellular responses to various stimuli. The PKR antibody can be utilized in a wide range of assays, including Western blotting, immunohistochemistry, and immunofluorescence.</p>

<p>The eIF2 alpha antibody is a polyclonal antibody used in Life Sciences research. It specifically targets and binds to eIF2 alpha, a protein involved in the regulation of translation initiation. This antibody is commonly used in studies related to insulin signaling, as well as in the development of therapeutic antibodies like trastuzumab and metoclopramide. In addition, it can be used as a tool for detecting eIF2 alpha autoantibodies or as a marker for identifying cells expressing high levels of this protein. The eIF2 alpha antibody has been proven to be highly specific and sensitive, making it an essential component in various research applications.</p>

<p>Purified Rabbit polyclonal ERF antibody (Thr526)</p>

<p>The SCGF antibody is a peptide agent that belongs to the globulin class of proteins. It is widely used in Life Sciences research as a growth factor and basic protein. This antibody acts as an anticoagulant and can be used in various applications such as immunoassays, western blotting, and immunohistochemistry. The SCGF antibody can also be conjugated with streptavidin for enhanced detection or used in combination with monoclonal antibodies for neutralizing specific targets. Additionally, this antibody has been shown to have catalase activity, making it useful for studying oxidative stress and antioxidant mechanisms in human serum. With its versatility and high specificity, the SCGF antibody is an invaluable tool for researchers in a wide range of fields.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of TXN2 antibody, catalog no. 70R-2433</p>

<p>S100 antibody was raised in rabbit using S-100 protein from bovine brain as the immunogen.</p>

<p>Mouse monoclonal MAPK8 antibody</p>

<p>Rabbit polyclonal GPR25 antibody</p>

<p>IRX3 antibody was raised in rabbit using the N terminal of IRX3 as the immunogen</p>

<p>Rabbit polyclonal THRB antibody</p>

<p>TMEM132B antibody was raised using the middle region of TMEM132B corresponding to a region with amino acids VQEWFHRGTPVGQEESTNKSTTPQSPMEGKNKLLKSGGPDAFTSFPTQGK</p>

<p>This antibody reacts with heavy chains on chicken IgG (IgY) and light chains on all chicken immunoglobulins.</p>

<p>GEMIN6 antibody was raised in Rabbit using Human GEMIN6 as the immunogen</p>

<p>Goat anti-cat IgG (FITC) was raised in goat using feline IgG F(ab')2 fragment as the immunogen.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of ALDH3A2 antibody, catalog no. 70R-6587</p>

<p>NRIP1 antibody was raised in mouse using recombinant Human Nuclear Receptor Interacting Protein 1 (Nrip1)</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of PRKACA antibody, catalog no. 70R-4594</p>

<p>The CD29 antibody is a highly effective monoclonal antibody that has a wide range of applications in the field of Life Sciences. It is particularly useful for detecting autoantibodies and alpha-fetoprotein, as well as for studying the function of various proteins and glycopeptides. The CD29 antibody can also be used to investigate the role of arginase and leukemia inhibitory factor in different biological processes.</p>

<p>Recombinant Human CST7 protein with His tag</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of Arnt antibody, catalog no. 70R-7857</p>

<p>Rabbit polyclonal PDIA3 antibody (FITC)</p>

<p>The PNMT antibody is an extracellular antigen that plays a crucial role in reductive processes. It can be used in various applications, including adeno-associated virus research and the development of therapeutic antibodies. The PNMT antibody is a highly specific monoclonal antibody that targets the activated form of the PNMT protein complex. It has been extensively tested and shown to have neutralizing properties against multidrug-resistant strains. This antibody is widely used in the life sciences field for its ability to detect and study low-density protein complexes. With its high specificity and soluble nature, the PNMT antibody is an invaluable tool for researchers in need of reliable and accurate detection methods.</p>

<p>The LIMK2 antibody is a highly specialized monoclonal antibody that targets and inhibits the activity of LIM domain kinase 2 (LIMK2). This antibody is widely used in various immunoassays and research applications to study the role of LIMK2 in cellular processes.</p>

<p>This antibody reacts with heavy (gamma) chains on mouse IgG and light chains on all mouse immunoglobulins.</p>

<p>The Claudin 7 antibody is a highly effective monoclonal antibody that targets the glycoprotein Claudin 7. It has anti-VEGF (vascular endothelial growth factor) properties and can inhibit the activity of epidermal growth factor. This antibody is widely used in Life Sciences research, particularly in studies related to antibodies, monoclonal antibodies, and polyclonal antibodies. The Claudin 7 antibody has been extensively characterized and is known for its high specificity and affinity for its target. It can be used in various applications such as immunohistochemistry, Western blotting, ELISA, and flow cytometry. With its unique properties and versatility, the Claudin 7 antibody is an essential tool for scientists working in the field of molecular biology and cellular research.</p>

<p>Salmonella antibody was raised in mouse using flagellum protein present in most Salmonella species as the immunogen.</p>

<p>Arntl2 antibody was raised in rabbit using the C terminal of Arntl2 as the immunogen</p>

<p>The EGFR antibody is a highly specialized antibody that targets the epidermal growth factor receptor (EGFR). This receptor plays a crucial role in various cellular processes, including cell growth and proliferation. The EGFR antibody is widely used in Life Sciences research to study the function and regulation of EGFR.</p>

<p>The RhoA antibody is a powerful tool in the field of Life Sciences. It is a highly specific antibody that targets RhoA, a small GTPase protein involved in various cellular processes. This antibody can be used in both research and clinical settings to study the role of RhoA in different biological pathways.</p>

<p>The IGJ antibody is a histidine-rich monoclonal antibody that targets the alpha-fetoprotein (AFP), a growth factor involved in the regulation of cell proliferation and differentiation. This antibody binds to AFP, neutralizing its activity and preventing it from interacting with its target molecules. The IGJ antibody has been widely used in life science research, particularly in studies involving epidermal growth factor (EGF) signaling pathways. It can also be used as a therapeutic agent for diseases associated with abnormal EGF signaling, such as cancer. With its high specificity and affinity, this monoclonal antibody offers great potential for targeted therapy and precision medicine.</p>

<p>Rabbit Polyclonal FKHR antibody (Ser319)</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of TJP1 antibody, catalog no. 70R-6042</p>

<p>Purified Polyclonal CLCC1 antibody</p>

<p>Purified recombinant TBCC protein (His tag)</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of TRIT1 antibody, catalog no. 70R-7956</p>

<p>LAAM Conjugate for use in immunoassays</p>

<p>AKT2 antibody was raised in Mouse using a purified recombinant fragment of human Akt2 expressed in E. coli as the immunogen.</p>

<p>Plasminogen antibody was raised using the middle region of PLG corresponding to a region with amino acids LISPEWVLTAAHCLEKSPRPSSYKVILGAHQEVNLEPHVQEIEVSRLFLE</p>

<p>Rabbit polyclonal TRMT2B antibody</p>

<p>DPT antibody was raised in Rabbit using Human DPT as the immunogen</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of DDX28 antibody, catalog no. 70R-5025</p>

<p>ZNF389 antibody was raised in rabbit using the N terminal of ZNF389 as the immunogen</p>

<p>Affinity purified Rabbit polyclonal FGF22 antibody</p>

<p>Rabbit polyclonal ZIC1/2/3/4/5 antibody</p>

<p>Purified recombinant Human TATDN3 Protein (His tag)</p>

<p>The Cyclin A antibody is a polyclonal antibody that is used in Life Sciences research. It specifically targets cyclin A, a protein involved in cell cycle regulation. This antibody can be used to study the role of cyclin A in various cellular processes, including DNA replication and cell division. Additionally, it has been shown to have potential applications in the detection of insulin-like autoantibodies and alpha-synuclein antigen. The Cyclin A antibody is highly specific and sensitive, making it a valuable tool for researchers studying hormone peptides, growth factors, and virus surface antigens. With its ability to detect activated proteins, this antibody is essential for understanding the complex mechanisms of cellular signaling pathways.</p>

<p>Rabbit polyclonal PLEKHA9 antibody</p>