Biochemicals and Reagents

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of DDX39 antibody, catalog no. 70R-1399</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of PDGFB antibody, catalog no. 70R-5691</p>

<p>PPP1R15B antibody was raised in rabbit using the C terminal of PPP1R15B as the immunogen</p>

<p>C-myc antibody was raised in chicken using C-myc-KLH conjugate as the immunogen.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of Gpr88 antibody, catalog no. 70R-8542</p>

<p>Protein kinase inhibitor; broad spectrum</p>

<p>Laminin antibody (biotin) was raised in rabbit using non-reduced 400 kDa human laminin as the immunogen.</p>

<p>The PSAP antibody is a highly specific monoclonal antibody that targets the protein known as prosaposin (PSAP). It is widely used in life sciences research to study the role of PSAP in various biological processes. This antibody has been extensively tested and validated for its ability to detect PSAP in human serum and other biological samples.</p>

<p>Purified recombinant Human NFKBIB protein (His tag)</p>

<p>Tyrosinase protein:<br>Peptide Tyrosinase (Asp371) – HLA-A*0201 (YMDGTMSQV) is a human tyrosinase-derived (369-377) peptide by posttranslational conversion of the sequence YMNGTMSQV. Tyrosinase is an oxidase membrane-bound protein. Tyrosinase play a key role in the melanin synthesis pathway. Tyrosinase is presented on the surface of HLA-A*02:01 melanomas and also expressed in melanocytes. Tyrosinase has been still suggested to be a tumor antigen and might be implicated in improvement of immunotherapeutic strategies such as for efficient anticancer vaccine development.<br>Applications of Peptide Tyrosinase (Asp371) – HLA-A*0201 (YMDGTMSQV):<br>Peptide Tyrosinase (Asp371) – HLA-A*0201 (YMDGTMSQV) is used to stimulate specific cytotoxic T lymphocytes (CTL) in PBMCs and then to analyze CTL response especially the cytokine production by ELISPOT assay. Peptide Tyrosinase (Asp371) – HLA-A*0201 (YMDGTMSQV) is also involved in experimental therapies of metastatic melanoma by allogeneic hematopoietic stem cell transplantation. In fact, cytotoxic T cells were generated from peripherical blood mononuclear cells (PBMCs) of HLA-A*02:01 healthy donors after being stimulated by injection of Asp371 antigen (2). This strategy raises issues which concern the graft versus tumor (GvT) effect and graft versus host disease (GvHD).</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of Hspbp1 antibody, catalog no. 70R-9291</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of TLR5 antibody, catalog no. 70R-5979</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of ERCC5 antibody, catalog no. 70R-3326</p>

<p>MBD1 antibody was raised using the C terminal of MBD1 corresponding to a region with amino acids  VKQEPPDPEEDKEENKDDSASKLAPEEEAGGAGTPVITEIFSLGGTRFRD</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of Smpdl3a antibody, catalog no. 70R-9153</p>

<p>Omega-Conotoxin MVIIA is a neurotoxin that inhibits voltage-dependent calcium channels and has been shown to be effective against neuropathic pain, chronic pain, and inflammatory pain. The long-term efficacy of this drug is due to its ability to block cytosolic calcium, which leads to the activation of neurotrophic factors. Omega-Conotoxin MVIIA binds to specific protein targets and inhibits ion channel activity in neurons. This toxin can also inhibit the production of proinflammatory cytokines by blocking the activation of NF-κB through intracellular targets. Omega-Conotoxin MVIIA has been shown to have a wide range of therapeutic potentials, including as an analgesic for acute and chronic pain, as an anti-inflammatory agent, and as a neuroprotective agent for treating neuronal degeneration.</p>

<p>STRAP antibody was raised using the C terminal of STRAP corresponding to a region with amino acids ASGSEDGTLRLWQTVVGKTYGLWKCVLPEEDSGELAKPKIGFPETTEEEL</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of DLG2 antibody, catalog no. 70R-6620</p>

<p>Physalaemin is a vasoactive intestinal peptide that belongs to the family of exocrine hormones. It is resistant to intracellular degradation and has been shown to be a potent inhibitor of vasopressin. Physalaemin has been shown to affect blood pressure by stimulating receptors in the brain that decrease blood pressure, as well as blocking naloxone-induced increases in blood pressure. Physalaemin also interacts with pancreatic cells, which may be due to its amino acid composition and ability to inhibit the release of caerulein from the pancreas. The effects on muscle cells are unknown, but it has been shown to have an inhibitory effect on the pancreas and intestine.</p>

<p>Rabbit serum against growth hormone-releasing factor (GRF) or GHRH (growth hormone-releasing hormone).</p>

<p>Hepatitis E virus (HEV) is a virus that infects the liver and causes hepatitis. Recombinant HEV ORF2 protein was produced by recombinant techniques in Escherichia coli. The recombinant HEV ORF2 protein has been shown to be immunogenic in mice, rabbits, and humans. Immunodominant epitopes were found at amino acid positions 448-456 and 468-480.</p>

<p>Insulin-like 5 (INSL5) is a protein that in humans is encoded by the INSL5 gene. It belongs to the insulin family of proteins and has been shown to have a role in various biological functions. INSL5 binds to the insulin receptor, which induces apoptosis in cancer cells by inhibiting cyclin-dependent kinase activity and inducing cell cycle arrest. The expression of INSL5 can be used as a diagnostic marker for cervical cancer and may also be used as a potential biomarker for cancer tissues.</p>

<p>The Anti NO Synthase II (77-105) (Rat) Serum is a research tool that can be used to activate, ligand or receptor. It can also be used to study cell biology as well as protein interactions. The Anti NO Synthase II (77-105) (Rat) Serum can inhibit ion channels and is a high purity antibody. This serum is made of peptides and proteins.</p>

<p>Human CRF ELISA (1ea) is a high-quality, competitively priced ELISA kit for the quantitative measurement of human CRF in rat serum. This assay has been designed for use in detecting the presence of CRF in biological fluids for research purposes. The kit contains all necessary components to perform the assay and detailed instructions are included.</p>

<p>Please enquire for more information about Amyloid β (1-42) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Kallidin is a peptide that has regulatory effects on tissue remodeling, inflammatory responses, and the growth of new blood vessels. It is found in a number of tissues, including extracellular matrix proteins, where it acts as a regulator. Kallidin has been shown to regulate kinins, which are hormones that are responsible for the regulation of inflammation. Kallidin also regulates collagen and fibrinogen production by stabilizing these proteins. This peptide also induces leukocyte recruitment and polymorphonuclear leukocytes (PMN) activity. Kallidin can stimulate growth factor production and may play an important role in the stabilization of matrix proteins such as fibronectin.</p>

<p>CD28 antibody (PE) was raised in mouse using chicken CD28 as the immunogen.</p>

<p>CD49b antibody was raised in mouse using human CD49b as the immunogen.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of BTNL8 antibody, catalog no. 70R-6390</p>

<p>Anti-human mesothelin monoclonal antibody.</p>

<p>CD107b antibody was raised in mouse using human CD107b/LAMP-2</p>

<p>CD11a antibody (Azide free) was raised in mouse using human CD11a (LFA-1a) as the immunogen.</p>

<p>CD4a antibody (PE) was raised in mouse using CD4a as the immunogen.</p>

<p>CD19 antibody (FITC) was raised in mouse using CD19+ murine pre-B cell line as the immunogen.</p>

<p>CD11a antibody (PE-CY7) was raised in rat using murine CD11a (LFA-1a) as the immunogen.</p>

<p>CD3e antibody (Spectral Red) was raised in hamster using H-2Kb-specific murine cytotoxic T lymphocyte as the immunogen.</p>

<p>Renin protein is a crucial component in the regulation of blood pressure and fluid balance. It plays a key role in the renin-angiotensin-aldosterone system, which controls blood volume and systemic vascular resistance. Renin protein is produced and released by specialized cells in the kidneys called juxtaglomerular cells.</p>

<p>CD19 antibody (CY5) was raised in mouse using human CD19 as the immunogen.</p>

<p>CD18 antibody (PE) was raised in rat using cell membrane lysates derived from murine T cell lymphoma BW5147 as the immunogen.</p>

<p>CD45R antibody (PE-CY5.5) was raised in rat using abelson murine leukemia virus-induced pre-B tumor cells as the immunogen.</p>

<p>N-(2-Methoxyethyl)-3-[[4-(1-methyl-1H-pyrazol-4-yl)phenyl]methyl]-1H-indazole-5-carboxamide (MTPC) is a peptide that binds to the receptor site of the human G protein coupled receptor, which is important in signal transduction. MTPC has been shown to inhibit ion channels and reduce neuronal excitability. This compound is a high purity reagent for research purposes. It is used as an inhibitor of ligands binding to receptors or ion channels, or as a pharmacological tool for studying the function of these proteins.</p>

<p>This is a vivitide catalogue product. Please send your vivitide product enquiry to sales@vivitide.com for an up-to-date price and availability.</p>

<p>CD107b antibody (FITC) was raised in rat using glycoproteins purified from BALB/c mouse embryo 3T3 cell line as the immunogen.</p>

<p>The HbA1c Antibody is a monoclonal antibody that specifically targets the HbA1c molecule. Monoclonal antibodies are highly specific antibodies that are produced in the laboratory and can be used for various applications in the field of Life Sciences. The HbA1c Antibody is particularly useful in the detection and quantification of HbA1c levels, which is an important marker for monitoring long-term glucose control in individuals with diabetes. This antibody binds to HbA1c with high affinity, allowing for accurate measurement of its concentration in blood samples. It can be used in various assays, including ELISA, Western blotting, and immunohistochemistry, to detect and quantify HbA1c levels. The use of this antibody ensures reliable and reproducible results, making it an essential tool for researchers and healthcare professionals working in the field of diabetes management. In addition to its diagnostic applications, the HbA1c Antibody also has potential</p>

<p>CD45RC antibody (biotin) was raised in rat using an exon C-depentent epitope of the CD45 glycoprotein as the immunogen.</p>

<p>CD32 antibody (PE) was raised in mouse using human K562 tumor cells and L cells tranfected with human Fc gamma RII as the immunogen.</p>

<p>CD22 antibody (PE) was raised in rat using CD22 as the immunogen.</p>

<p>A monoclonal antibody fragment (nanobody) that binds to von Willebrand factor (vWF), thereby inhibiting platelet adhesion.</p>

<p>CD21 antibody (PE) was raised in mouse using porcine CD21 as the immunogen.</p>

<p>CD106 antibody (FITC) was raised in mouse using human endothelial cells as the immunogen.</p>

<p>CD45R antibody (PE-CY7) was raised in rat using abelson murine leukemia virus-induced pre-B tumor cells as the immunogen.</p>

<p>CD45R antibody (PE) was raised in rat using abelson murine leukemia virus-induced pre-B tumor cells as the immunogen.</p>

<p>CD122 antibody (Allophycocyanin) was raised in rat using rat myeloma YB2/0 transfected with truncated murine IL-2RB cDNA as the immunogen.</p>

<p>Streptococcus group A antibody (biotin) was raised in goat using group A Streptococci as the immunogen.</p>

<p>Anti-TIM-3 monoclonal antibody</p>

<p>CD117 antibody (PE) was raised in rat using murine CD117/c-Kit as the immunogen.</p>

<p>CD38 antibody (PE) was raised in rat using CD38 as the immunogen.</p>

<p>CD3e antibody (PE) was raised in hamster using H-2Kb-specific mouse cytotoxic T lymphocyte as the immunogen.</p>

<p>CD152 antibody (biotin) was raised in hamster using murine CD152/CTLA-4 as the immunogen.</p>

<p>CD40 antibody (Spectral Red) was raised in rat using CD40 as the immunogen</p>

<p>CD103 antibody (FITC) was raised in hamster using murine CD103 as the immunogen.</p>

<p>CD152 antibody (Azide free) was raised in hamster using keat-killed Staphylococcus A bacteria coated with murine CTLA-4/human IgG1 fusion protein as the immunogen.</p>

<p>CD18 antibody (FITC) was raised in rat using cell membrane lysates derived from murine T cell lymphoma BW5147 as the immunogen.</p>

<p>CD38 antibody (biotin) was raised in rat using CD38 as the immunogen.</p>

<p>CD19 antibody (PE-CY7) was raised in rat using murine CD19-expressing K562 human erythroleukemia cells as the immunogen.</p>

<p>CD106 antibody (PE) was raised in rat using murine CD106/VCAM-1 as the immunogen.</p>

<p>CD152 antibody (FITC) was raised in hamster using murine CD152/CTLA-4 as the immunogen.</p>

<p>CD117 antibody (biotin) was raised in rat using murine CD117/c-Kit as the immunogen.</p>

<p>CD19 antibody (biotin) was raised in rat using murine CD19-expressing K562 human erythroleukemia cells as the immunogen.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of CACNB1 antibody, catalog no. 70R-5073</p>

<p>CD28 antibody (biotin) was raised in mouse using chicken CD28 as the immunogen.</p>

<p>CD25 antibody (Allophycocyanin) was raised in rat using alpha chain IL-2 receptor as the immunogen.</p>

<p>CD24 antibody (FITC) was raised in rat using murine heat stable antigen as the immunogen.</p>

<p>CD11c antibody (biotin) was raised in mouse using human rheumatoid synovial fluid cells/monocytes as the immunogen.</p>

<p>Anti Acidic-FGF (1-15) (Bovine) Serum is a research tool used to study the activation of FGF receptors and their ligands. It contains peptides that are derived from the extracellular domain of human acidic FGF (1-15). This serum stimulates the activation of FGF receptors, which are important in cell growth, proliferation, and survival. Anti Acidic-FGF (1-15) Serum is purified by ion exchange chromatography and contains no detectable amounts of other proteins. It is supplied as a lyophilized powder at a concentration of 10 mg/mL.</p>

<p>Insulin II is a peptide hormone that is secreted by the beta cells of the pancreas. Insulin II regulates glucose metabolism, promotes protein synthesis and inhibits lipolysis. It can be used as a research tool to study protein interactions, activators and ligands, receptor binding and ion channel activity. Insulin II can also be used to generate monoclonal antibodies against insulin II.<br>This product has the three code sequence: A-chain: Gly-Ile-Val-Asp-Gln-Cys-Cys-Thr-Ser-Ile-Cys-Ser-Leu-Tyr-Gln-Leu-Glu-Asn-Tyr-Cys-Asn ; B-chain:Phe-Val-Lys-Gln-His-Leu-Cys-Gly-Ser-His-Leu-Val-Glu-Ala-Leu-Tyr-Leu-Val-Cys-Gly-Glu-Arg-Gly-Phe-Phe-Tyr-Thr-Pro-Met-Ser, has the disulfide bonds: CysA6-CysA11, CysA7-CysB7, and CysA20-CysB19 and is available as a 50 µg vial.</p>

<p>This product is produced via the activation of mariculture Keyhole Limpet (Megathura crenulata) Hemocyanin with a maleimide group.  The activated material will readily bind free sulfhydryl groups present in solution.KLH is a highly antigenic protein with a high molecular mass (4.5 x 105 - 1.3 x 107 Daltons, in aggregates of 350 and 390 kDa subunits) that elicits a strong immune response when used to immunize animals.As many as 400 moles of Cysteine-containing peptide can bind to one mole of maleimide-activated KLH.</p>

<p>Enolase-1 is a glycolytic enzyme that catalyzes the conversion of 2-phosphoglycerate to phosphoenolpyruvate. It is a homotetrameric enzyme composed of two alpha and two beta subunits. Enolase-1 has been shown to be an ion channel in some cells, and has been implicated in the regulation of cellular processes such as cell proliferation, migration, and apoptosis. The recombinant protein is produced by HEK293 cells and purified by proprietary chromatography techniques.</p>

<p>CD25 antibody (PE-CY7) was raised in rat using alpha chain IL-2 receptor as the immunogen.</p>

<p>CD106 antibody (PE) was raised in Mouse using human CD106/VCAM-1 as the immunogen.</p>

<p>CD45.1 antibody (CY5) was raised in mouse using CD45.1 as the immunogen.</p>

<p>CD44 antibody (biotin) was raised in mouse using human CD44 as the immunogen</p>

<p>CD24 antibody (biotin) was raised in rat using murine heat stable antigen as the immunogen.</p>

<p>CD117 antibody (CY5) was raised in rat using murine CD117/c-Kit as the immunogen.</p>

<p>CD3e antibody (biotin) was raised in rat using CD3e as the immunogen.</p>

<p>Low control human Serum</p>

<p>E. coli O157 antibody (FITC) was raised in mouse using 'O' antigen of E. coli serotype O157 as the immunogen.</p>

<p>CD45.2 antibody (PE) was raised in mouse using CD45.2 as the immunogen.</p>

<p>Antibody-drug conjugate (ADC) of HER2-targeted trastuzumab with cytotoxic microtubule-inhibitory agent DM1 (derivative of maytansine).</p>

<p>Induce B cell depletion and inhibits multiple sclerosis lesions in mice</p>

<p>CD16 antibody (FITC) was raised in rat using murine CD16/32 (CD16/Fc gamma II and CD32/Fc gamma III receptors)</p>

<p>Troponin T protein is a highly specific biomarker used in the diagnosis of cardiac conditions. It is a DNA aptamer that binds to troponin T, neutralizing its activity. This protein is found in human serum and its levels are elevated in cases of myocardial infarction or other cardiac events. Troponin T protein can be measured using immunoassays, such as monoclonal antibody-based assays or electrode immobilization techniques. It is commonly used in clinical settings to assess cardiac health and monitor patients undergoing treatment with medications like sorafenib. The use of Troponin T protein in Life Sciences research has significantly contributed to advancements in the understanding of cardiac diseases and the development of new diagnostic tools.</p>

<p>CD8a antibody (Azide free) was raised in rat using murine thymus or spleen as the immunogen.</p>

<p>CD49b antibody (Allophycocyanin) was raised in rat using RIL-2-propagated NK1.1+ cells from C57BL/6 mice as the immunogen.</p>

<p>CD3e antibody (CY5) was raised in hamster using T cell receptor complexes derived from C6VL-BS thymoma cells as the immunogen.</p>

<p>Rabbit polyclonal TNFSF14 antibody</p>

<p>Ivuxolimab is an OX40 (also known as CD134; TNFRSF4) agonist monoclonal antibody.</p>

<p>CD44 antibody (FITC) was raised in rat using murine CD44 as the immunogen.</p>

<p>CD49b antibody (FITC) was raised in rat using RIL-2-propagated NK1.1+ cells from C57BL/6 mice as the immunogen.</p>

<p>CD45 antibody (Allophycocyanin) was raised in mouse using chicken CD45 as the immunogen.</p>

<p>CD49d antibody (Azide free) was raised in rat using the alpha-4 chain of the VLA-4 integrin heterodimer as the immunogen.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of FCER1G antibody, catalog no. 70R-8649</p>

<p>CD49b antibody (PE) was raised in rat using RIL-2-propagated NK1.1+ cells from C57BL/6 mice as the immunogen.</p>

<p>CD45.1 antibody (PE) was raised in mouse using CD45.1 as the immunogen.</p>

<p>RHOG antibody was raised in rabbit using the C terminal of RHOG as the immunogen</p>

<p>CD117 antibody (Allophycocyanin) was raised in rat using murine CD117/c-Kit as the immunogen.</p>

<p>CD25 antibody (Allophycocyanin) was raised in rat using IL-2-dependent BALB/c mouse helper T-cell clone HT-2 as the immunogen.</p>

<p>Anti-Human SLAMF7 Monoclonal Antibody</p>

<p>HSV2 gE antibody (FITC) was raised in mouse using HSV 2, gE as the immunogen.</p>

<p>CD22 antibody (biotin) was raised in rat using CD22 as the immunogen.</p>

<p>Dostarlimab binds with high affinity to human PD-1 and competitively inhibits its interaction with its ligands PD-L1 and PD-L2</p>

<p>CD11b antibody (FITC) was raised in rat using peritoneal macrophages from C57 B1/6 x DBA/2 F1 hybrid mice as the immunogen.</p>

<p>CD4a antibody (FITC) was raised in mouse using CD4a as the immunogen.</p>

<p>Anti-Human IL-4R Monoclonal Antibody</p>

<p>CD20 antibody (Allophycocyanin) was raised in mouse using human CD20 as the immunogen.</p>

<p>CD3e antibody (PE) was raised in hamster using H-2Kb-specific mouse cytotoxic T lymphocyte as the immunogen.</p>

<p>CD3e antibody (FITC) was raised in hamster using H-2Kb-specific murine cytotoxic T lymphocyte as the immunogen.</p>

<p>CD11a antibody (PE) was raised in rat using murine CD11a (LFA-1a) as the immunogen.</p>

<p>CD38 antibody (Spectral Red) was raised in rat using CD38 as the immunogen.</p>

<p>CD45 antibody (FITC) was raised in Rat using as exon C-dependent epitope of CD45 glycoprotin as the immunogen.</p>

<p>CD49d antibody (PE) was raised in mouse using human CD49d as the immunogen.</p>

<p>CD122 antibody (FITC) was raised in rat using rat myeloma YB2/0 transfected with truncated murine IL-2RB cDNA as the immunogen.</p>

<p>CD45RB antibody (biotin) was raised in rat using cloned murine Th2 cell lines as the immunogen.</p>

<p>CD11b antibody (CY5) was raised in rat using C57BL/10 murine splenic T-cells and concanavalin A-activted C57BL/10 splenocytes as the immunogen.</p>

<p>CD3e antibody (FITC) was raised in mouse using porcine CD3e as the immunogen.</p>

<p>Catestatin is a peptide that belongs to the family of activators. Catestatin is an activator of potassium channels and can be used as a research tool. It has been shown to bind to the Kv1.2 receptor, which is expressed in human heart and skeletal muscle cells. This peptide also inhibits calcium-activated potassium channels, thereby blocking the transmission of nerve impulses. Catestatin has been shown to inhibit protein interactions with G protein-coupled receptors (GPCRs) and ion channels, thereby regulating cellular signaling pathways involved in cell growth and differentiation.</p>

<p>1-Myristoyl-sn-glycero-3-phosphocholine is a phospholipid that is used as a surfactant. It has been shown to increase the volume of human serum and pancreatic enzymes, which may be due to its matrix effect on tissue samples. 1-Myristoyl-sn-glycero-3-phosphocholine also binds with fatty acids and kynurenine in vitro. In this experiment, it was observed that 1-myristoyl-sn glycero 3 phosphatecholine increased the activity of kynurenine hydroxylase, an enzyme involved in the metabolism of tryptophan. This suggests that 1 myristoyl sn glycero 3 phosphocholine may be beneficial for patients with chronic fatigue syndrome or depression who are deficient in serotonin.</p>

<p>Anti-PACAP27 is a human serum protein that belongs to the class of peptides. It is an inhibitor of PACAP27, which is a potent stimulator of nerve cells in the brain. Anti-PACAP27 has been used as a research tool to study the interactions between proteins and antibodies, and it can be used as an ion channel or receptor ligand. Anti-PACAP27 binds to PACAP27 with high affinity and inhibits its activity by binding to its receptor. This inhibition prevents the activation of nerve cells in the brain, leading to research into neurological disorders such as Parkinson's disease.</p>

<p>CTX-712 is an innovative small-molecule inhibitor, which is synthesized through state-of-the-art organic chemical processes. This compound functions by selectively targeting and inhibiting specific intracellular pathways critical for tumor cell proliferation and survival. Through its precise mechanism of disrupting key signaling cascades, CTX-712 effectively impairs the growth of cancer cells while minimizing the impact on normal, healthy tissues.</p>

<p>Recombinant human IL-1alpha</p>

<p>Please enquire for more information about Thyroid Stimulating Hormone Human including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Purified native Human Hemoglobin Ao protein (Glycated)</p>

<p>Please enquire for more information about H-GVDDAFYTL-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the class of rifamycins. It is specifically designed to combat tuberculosis infection by targeting active compounds and exhibiting bactericidal activity. This drug inhibits bacterial growth by binding to DNA-dependent RNA polymerase, effectively preventing transcription and replication. Its effectiveness has been demonstrated through extensive research using the patch-clamp technique on human erythrocytes.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of PLCB1 antibody, catalog no. 70R-5669</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of UBE2I antibody, catalog no. 70R-1159</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of SERPINB13 antibody, catalog no. 70R-7068</p>

<p>The HIV1 gp120 protein is a growth factor and monoclonal antibody that plays a crucial role in the replication of the HIV virus. It binds to CD4 receptors on human cells, allowing the virus to enter and infect the host. The gp120 protein has been extensively studied in Life Sciences research, particularly in the development of vaccines and antiretroviral therapies. It can be used as a target for neutralizing antibodies and as a tool for studying the interaction between the virus and human serum. The recombinant form of gp120 exhibits high purity and photostability, making it ideal for various laboratory applications. Additionally, studies have shown that this protein interacts with other molecules such as glutamate, interferon, dopamine, tgf-beta, imatinib, and collagen, suggesting its involvement in multiple cellular processes.</p>

<p>Oxytocin is an endogenous hormone.</p>

<p>CD11b antibody (FITC) was raised in rat using C57BL/10 murine splenic T-cells and concanavalin A-activted C57BL/10 splenocytes as the immunogen.</p>

<p>CD44 antibody (PE) was raised in mouse using chicken CD44 as the immunogen.</p>

<p>CD45.2 antibody (PE-CY7) was raised in mouse using CD45.2 as the immunogen.</p>

<p>CD107a antibody (FITC) was raised in rat using murine CD107a (LAMP-1) as the immunogen.</p>

<p>CD23 antibody (Allophycocyanin) was raised in rat using CD23 low affinity IgE Fc receptor as the immunogen.</p>

<p>CD79b antibody (Azide free) was raised in hamster using the beta chain of the murine B-cell receptor as the immunogen.</p>

<p>CD3e antibody (FITC) was raised in mouse using porcine CD3e as the immunogen.</p>

<p>CD45R antibody (FITC) was raised in rat using abelson murine leukemia virus-induced pre-B tumor cells as the immunogen.</p>

<p>CD40 antibody (biotin) was raised in rat using CD40 as the immunogen</p>

<p>CD19 antibody (PE-CY5.5) was raised in rat using murine CD19-expressing K562 human erythroleukemia cells as the immunogen.</p>

<p>CD107a antibody (Allophycocyanin) was raised in rat using murine CD107a (LAMP-1) as the immunogen.</p>

<p>CD11b antibody (PE was raised in rat using C57BL/10 murine splenic T-cells and concanavalin A-activted C57BL/10 splenocytes as the immunogen.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of C22orf28 antibody, catalog no. 70R-4339</p>

<p>CD45.2 antibody (CY5) was raised in mouse using CD45.2 as the immunogen.</p>

<p>CD123/CD3 bispecific dual-affinity retargeting antibody (DART)</p>