Biochemicals and Reagents

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of RNF6 antibody, catalog no. 70R-2741</p>

<p>The STAT1 antibody is a highly specialized monoclonal antibody that specifically targets and binds to the activated form of STAT1 protein. This antibody has been widely used in life sciences research to study various cellular processes and signaling pathways involving STAT1.</p>

<p>Recombinant human UNC119B protein (His tag)</p>

<p>Rabbit polyclonal RPS9 antibody (FITC)</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of SSTR1 antibody, catalog no. 70R-9812</p>

<p>Rabbit polyclonal ATF5 antibody</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of MAP4K2 antibody, catalog no. 70R-5784</p>

<p>TGFB3 protein is a growth factor that plays a crucial role in various biological processes. It is involved in the regulation of cell proliferation, differentiation, and apoptosis. TGFB3 protein has been shown to have cytotoxic effects on cancer cells and can inhibit their growth. It also plays a role in wound healing by promoting collagen synthesis. Additionally, TGFB3 protein is known to regulate the expression of lipoprotein lipase, which is involved in lipid metabolism. This protein can be used as a medicament for the treatment of certain diseases and disorders. Its therapeutic potential extends to conditions such as inflammation, autoimmune diseases, and neurodegenerative disorders. TGFB3 protein has also been found to interact with other molecules such as chemokines and annexins, further highlighting its importance in cellular signaling pathways. With its diverse functions and interactions, TGFB3 protein is a valuable tool for researchers in the field of life sciences studying various biological processes and developing new therapeutic strategies.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of SPAG8 antibody, catalog no. 70R-2386</p>

<p>MLDP antibody was raised in Guinea Pig using synthetic peptide C-terminal aa 451-463 of human MLDP as the immunogen.</p>

<p>The Elk1 antibody is a highly specialized polyclonal antibody used in Life Sciences research. It is designed to specifically target and bind to the Elk1 protein, which plays a crucial role in gene expression regulation. The Elk1 antibody can be used for various applications such as immunohistochemistry, western blotting, and ELISA.</p>

<p>Affinity purified Rabbit polyclonal KHS antibody</p>

<p>Neisseria Gonorrhoeae Antibody is a growth factor that targets the annexin A2 protein. This monoclonal antibody has been developed to specifically bind to Neisseria gonorrhoeae, a bacteria responsible for causing the sexually transmitted infection gonorrhea. By targeting and binding to specific proteins on the surface of the bacteria, this antibody helps in neutralizing and eliminating the pathogen from the body. Additionally, this antibody has shown potential in inhibiting the attachment of N. gonorrhoeae to host cells, preventing its entry and subsequent infection.</p>

<p>Legionella pneumophila Monoclonal Antibody</p>

<p>Rabbit Polyclonal CDC2 antibody (Tyr15)</p>

<p>The HDAC4 antibody is a highly specific monoclonal antibody that is used for the treatment and/or prophylaxis of various diseases. It is commonly used in immunoassays and research studies in the field of Life Sciences. This antibody can be immobilized on an electrode or coupled with streptavidin for quantitation purposes. The HDAC4 antibody has been shown to have anti-angiogenic properties, making it a potential therapeutic option for diseases characterized by abnormal blood vessel growth. Its high specificity and affinity make it an ideal tool for the detection and analysis of HDAC4 in human serum samples. Additionally, this antibody can be used as an inhibitor to study the role of HDAC4 in various cellular processes, such as gene expression and protein regulation. With its wide range of applications, the HDAC4 antibody is a valuable tool for researchers in both academia and industry.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of TKT antibody, catalog no. 70R-2587</p>

<p>ETS2 antibody was raised in Rabbit using Human ETS2 as the immunogen</p>

<p>CCNDBP1 antibody was raised in rabbit using the middle region of CCNDBP1 as the immunogen</p>

<p>Purified recombinant Human THTPA protein</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of CCNB3 antibody, catalog no. 70R-8395</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of OMG antibody, catalog no. 70R-6385</p>

<p>Aadacl1 antibody was raised in rabbit using the middle region of Aadacl1 as the immunogen</p>

<p>The HER2 antibody is a highly specialized antibody used in the field of Life Sciences. It can be either a polyclonal or monoclonal antibody, designed to target the HER2 protein molecule. This protein is found on the surface of certain cancer cells and is associated with aggressive tumor growth.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of CUGBP2 antibody, catalog no. 70R-4819</p>

<p>ACOT12 antibody was raised using the middle region of ACOT12 corresponding to a region with amino acids SASRLCWAHPFLKSVDMFKFRGPSTVGDRLVFTAIVNNTFQTCVEVGVRV</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of RGS13 antibody, catalog no. 70R-1144</p>

<p>CD11a antibody was raised in mouse using human CD11a (LFA-1a) as the immunogen.</p>

<p>The CD42c antibody is a potent inhibitor that targets the platelet membrane. It acts as a metastasis inhibitor by preventing the attachment of cancer cells to platelets, thereby inhibiting their spread to other parts of the body. The CD42c antibody can be used in various applications, including in vitro experiments and life sciences research. It is commonly used in immunosorbent assays and can also be conjugated to liposomes or protein microparticles for targeted drug delivery. This polyclonal antibody specifically recognizes and binds to activated CD42c glycoprotein on platelets, providing a reliable tool for studying platelet function and related disorders. With its high specificity and efficacy, the CD42c antibody is an essential component for researchers and scientists working in the field of platelet biology and metastasis inhibition.</p>

<p>Mouse monoclonal HBsAg antibody (Gold Colloid)</p>

<p>Tmem33 antibody was raised in rabbit using the middle region of Tmem33 as the immunogen</p>

<p>SARS antibody was raised using the middle region of SARS corresponding to a region with amino acids SQFDEELYKVIGKGSEKSDDNSYDEKYLIATSEQPIAALHRDEWLRPEDL</p>

<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the class of rifamycins. It is highly effective in treating tuberculosis infections due to its potent bactericidal activity. This drug works by binding to DNA-dependent RNA polymerase, preventing transcription and replication, thereby inhibiting bacterial growth. Extensive studies have demonstrated its efficacy using advanced techniques like transcription-quantitative polymerase chain and patch-clamp technique. The active form of this drug undergoes various metabolic transformations, including hydrolysis by esterases or glucuronidases, oxidation by cytochrome p450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, it specifically targets Mycobacterium tuberculosis strains and inhibits their cell growth in culture.</p>

<p>ARVCF Oxidase antibody was raised in Guinea Pig using Two synthetic peptides of human ARVCF as the immunogen.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of FLYWCH1 antibody, catalog no. 70R-10075</p>

<p>Rabbit polyclonal VOPP1 antibody (biotin)</p>

<p>Rabbit polyclonal AFX antibody</p>

<p>COX8A antibody was raised in Rabbit using Human COX8A as the immunogen</p>

<p>The EGFR antibody is a cytotoxic monoclonal antibody that targets the epidermal growth factor receptor (EGFR). It is used as a diagnostic reagent in the field of life sciences to detect and measure the levels of EGFR protein biomarkers. This antibody specifically recognizes and binds to EGFR, inhibiting its activation and downstream signaling pathways. By blocking the interaction between EGFR and its ligands, such as epidermal growth factor, the antibody effectively inhibits cell proliferation and survival. The EGFR antibody has been extensively studied for its potential therapeutic applications in cancer treatment, particularly in tumors that overexpress EGFR. Additionally, this antibody has shown promising results in preclinical studies as a potential nephrotoxic agent due to its ability to inhibit hydroxylase activity. Overall, the EGFR antibody is a valuable tool for researchers and clinicians in studying and targeting EGFR-related diseases.</p>

<p>Purified Rabbit polyclonal ITGB1 antibody (Tyr795)</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of H1FOO antibody, catalog no. 70R-2024</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of GBA3 antibody, catalog no. 70R-9508</p>

<p>MAT1A antibody was raised using the C terminal of MAT1A corresponding to a region with amino acids VAKSLVKAGLCRRVLVQVSYAIGVAEPLSISIFTYGTSQKTERELLDVVH</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of APOBEC2 antibody, catalog no. 70R-1425</p>

<p>BCHE antibody was raised using the N terminal of BCHE corresponding to a region with amino acids SSLHVYDGKFLARVERVIVVSMNYRVGALGFLALPGNPEAPGNMGLFDQQ</p>

<p>This antibody reacts with heavy chains on Goat IgG and light chains on all Goat immunoglobulins.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of KRT20 antibody, catalog no. 70R-1189</p>

<p>Rabbit polyclonal Breast Tumor Kinase antibody</p>

<p>The Ku70 antibody is a highly specialized monoclonal antibody used in the field of Life Sciences. It targets and inhibits the activity of hepatocyte growth factor, a key growth factor involved in various cellular processes. This antibody can be used for research purposes to study the role of hepatocyte growth factor in different biological systems.</p>

<p>Rabbit polyclonal PSME2 antibody (HRP)</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of GZMK antibody, catalog no. 70R-7203</p>

<p>The Tau antibody is a highly specialized Polyclonal Antibody that targets the annexin protein. It is commonly used in Life Sciences research for its ability to inhibit the activity of oncostatin and anti-cd33 antibodies. This monoclonal antibody offers a powerful tool for researchers studying the role of annexin in various cellular processes.</p>

<p>The p53 antibody is a highly sought-after product in the field of Life Sciences. It is an antibody that specifically targets and binds to the p53 protein, which plays a crucial role in regulating cell growth and preventing tumor formation. This monoclonal antibody has been extensively tested and validated for its specificity and sensitivity in detecting p53 protein expression in human serum samples.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of SRA1 antibody, catalog no. 70R-10353</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of SIGLEC7 antibody, catalog no. 70R-6142</p>

<p>Cytokeratin 18 protein is a vital component of the cytoskeleton in epithelial cells. It is commonly used as a biomarker for the detection and diagnosis of various types of cancers, including breast, lung, and liver cancer. Monoclonal antibodies specific to cytokeratin 18 protein are widely used in research and diagnostic assays to detect its presence in tissues or body fluids. These antibodies can be used in immunohistochemistry, western blotting, or ELISA assays to accurately quantify cytokeratin 18 protein levels.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of UBE2D2 antibody, catalog no. 70R-1828</p>

<p>Rabbit polyclonal TPMT antibody</p>

<p>The PIK3R3 antibody is a powerful tool in the field of biomedical research. It specifically targets lyso-gb1, an antigen that plays a crucial role in various cellular processes. This polyclonal antibody can be used to detect and study the expression of lyso-gb1 in different tissues and cell types.</p>

<p>Rabbit polyclonal ZNF436 antibody</p>

<p>Rabbit polyclonal PKC theta antibody (Thr505)</p>

<p>Rabbit polyclonal CXCL5 antibody (biotin)</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of INSR antibody, catalog no. 70R-10509</p>

<p>Rabbit polyclonal Rab1A antibody (FITC)</p>

<p>The Myc Tag antibody is a highly reactive antibody that is commonly used in Life Sciences research. It specifically targets the Myc epitope, which is a small protein tag often fused to target proteins for detection and purification purposes. This antibody has been extensively validated and shown to have high affinity and specificity for the Myc tag.</p>

<p>Purified recombinant Human PNP protein</p>

<p>Rabbit polyclonal ABL1 antibody (biotin)</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of LAP3 antibody, catalog no. 70R-2902</p>

<p>Affinity purified Rabbit polyclonal AKAP10 antibody</p>

<p>Affinity purified Rabbit polyclonal HMBOX1 antibody</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of TROVE2 antibody, catalog no. 70R-1372</p>

<p>The p53 antibody is a neutralizing monoclonal antibody that targets the influenza hemagglutinin protein. It is commonly used in Life Sciences research to study the effects of various growth factors and drugs, such as pioglitazone, on cellular processes. The p53 antibody is produced by hybridoma cells and has been shown to specifically bind to p53 protein expressed in human hepatocytes and other cell types. This antibody can be used for applications such as immunofluorescence, immunohistochemistry, and Western blotting to detect and quantify the levels of p53 protein in various samples. Its high specificity and affinity make it a valuable tool for researchers studying cell signaling pathways, cancer biology, and other related fields.</p>

<p>XAB2 antibody was raised in rabbit using the N terminal of XAB2 as the immunogen</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of MAGED2 antibody, catalog no. 70R-9922</p>

<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the class of rifamycins. It is highly effective in treating tuberculosis infections, as it contains active compounds with bactericidal activity. By binding to DNA-dependent RNA polymerase, this drug inhibits bacterial growth, preventing transcription and replication. Its potency has been demonstrated through the use of a patch-clamp technique on human erythrocytes. The drug undergoes various metabolic transformations, including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, it specifically targets markers expressed at high levels in Mycobacterium tuberculosis strains and inhibits their cell growth in culture.</p>

<p>CRCP antibody was raised in Rabbit using Human CRCP as the immunogen</p>

<p>The PCBP2 antibody is a polyclonal antibody that specifically targets the PCBP2 protein. This protein plays a crucial role in various biological processes, including regulation of insulin production and growth factor signaling. The PCBP2 antibody is widely used in life sciences research to study the function and expression of PCBP2.</p>

<p>Pigw antibody was raised in rabbit using the middle region of Pigw as the immunogen</p>

<p>Rabbit polyclonal CGK2 antibody</p>

<p>Purified recombinant Human BCL7A protein (His tag)</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of PRSS16 antibody, catalog no. 70R-6967</p>

<p>AHR antibody was raised in Rabbit using Human AHR as the immunogen</p>

<p>Enterovirus antibody is a biomolecule that specifically targets the glycoprotein of enteroviruses. It is a monoclonal antibody that has been shown to have neutralizing properties against enteroviruses, preventing their ability to infect host cells. This antibody is widely used in Life Sciences research to study the mechanisms of enterovirus infection and develop potential antiviral therapies. Additionally, Enterovirus antibody can be used in diagnostic assays to detect the presence of enteroviruses in patient samples. Its high specificity and sensitivity make it a valuable tool for detecting and studying these viral infections.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of NDRG1 antibody, catalog no. 70R-1123</p>

<p>MDR1 antibody is a chemokine that belongs to the group of polyclonal antibodies. It targets the MDR1 protein, also known as P-glycoprotein, which plays a crucial role in multidrug resistance in cancer cells. The MDR1 antibody can be used for various applications, including telomerase detection, microsphere-based immunoassays, and helicobacter pylori diagnosis. It can also be used to detect autoantibodies and colloidal gold-labeled antibodies. Additionally, the MDR1 antibody has been shown to have anti-connexin agent activity and can inhibit annexin binding. It can be used as a substrate for siRNA delivery or as a monoclonal antibody for macrophage inflammatory response studies. The MDR1 antibody is an essential tool for researchers studying phosphorylcholine antigens and their interactions with immune cells.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of SLCO6A1 antibody, catalog no. 70R-1799</p>

<p>Rad21 antibody was raised in rabbit using the C terminal of Rad21 as the immunogen</p>

<p>Goat anti-human IgG (H+L) (Fab'2) was raised in goat using human IgG whole molecule as the immunogen.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of MDP-1 antibody, catalog no. 70R-3521</p>

<p>Rabbit Polyclonal Keratin 8 antibody (Ser74)</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of CRBN antibody, catalog no. 70R-3211</p>

<p>Goat anti-Guinea Pig IgG (H + L) (Alk Phos) was raised in goat using purified Guinea Pig IgG (H&amp;L) as the immunogen.</p>

<p>1-191 amino acids: MGKQNSKLAP EVMEDLVKST EFNEHELKQW YKGFLKDCPS GRLNLEEFQQ LYVKFFPYGD ASKFAQHAFR TFDKNGDGTI DFREFICALS ITSRGSFEQK LNWAFNMYDL DGDGKITRVE MLEIIEAIYK MVGTVIMMKM NEDGLTPEQR VDKIFSKMDK NKDDQITLDE FKEAAKSDPS IVLLLQCDIQ K</p>

<p>The MASP2 antibody is a highly specialized product designed for use in the Life Sciences field. This antibody possesses unique characteristics that make it an essential tool for various applications. With its high viscosity and anticoagulant properties, this antibody is particularly useful in studies involving glycoproteins and fibrinogen. It has been extensively tested and proven to be effective in neutralizing specific targets, making it an invaluable asset in research and diagnostic settings.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of C14orf44 antibody, catalog no. 70R-4163</p>

<p>Rabbit polyclonal GLPK antibody</p>

<p>CNP antibody was raised using the N terminal of CNP corresponding to a region with amino acids YKITPGARGAFSEEYKRLDEDLAAYCRRRDIRILVLDDTNHERERLEQLF</p>

<p>Rabbit Polyclonal PLCG1 antibody (Tyr783)</p>

<p>LIN9 antibody was raised in rabbit using the N terminal of LIN9 as the immunogen</p>

<p>USP30 antibody was raised in rabbit using the middle region of USP30 as the immunogen</p>

<p>Dct antibody was raised in rabbit using the middle region of Dct as the immunogen</p>

<p>KDR antibody was raised in Mouse using purified recombinant extracellular fragment of human KDR (aa20-764) fused with hIgGFc tag expressed in HEK293 cells as the immunogen.</p>

<p>6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the class of rifamycins. This particular compound is highly effective in treating tuberculosis infections due to its potent bactericidal activity. It works by binding to DNA-dependent RNA polymerase, which inhibits bacterial growth and prevents transcription and replication. The effectiveness of 6-Fluoro-3-indoxyl-beta-D-galactopyranoside has been extensively studied using advanced techniques such as transcription-quantitative polymerase chain reaction and patch-clamp technique. This drug undergoes various metabolic transformations, including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, it specifically targets markers expressed in Mycobacterium tuberculosis strains and inhibits their growth in culture.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of LOC391766 antibody, catalog no. 70R-9051</p>

<p>Rabbit polyclonal MORF4L1 antibody</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of REM1 antibody, catalog no. 70R-4066</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of RGL3 antibody, catalog no. 70R-9377</p>

<p>BDH2 antibody was raised using the middle region of BDH2 corresponding to a region with amino acids NRCVYSTTKAAVIGLTKSVAADFIQQGIRCNCVCPGTVDTPSLQERIQAR</p>

<p>Purified recombinant Human RQCD1 protein</p>

<p>The Cytoglobin antibody is a polyclonal antibody that has been developed to target the Cytoglobin protein. This protein is involved in various biological processes, including cell growth and differentiation. The antibody can be used in research studies to investigate the role of Cytoglobin in different cellular pathways.</p>

<p>ABI2 antibody was raised in Rabbit using Human ABI2 as the immunogen</p>

<p>Prothrombin factor II antibody was raised in sheep using human Prothrombin purified from plasma as the immunogen.</p>

<p>WDR53 antibody was raised using the middle region of WDR53 corresponding to a region with amino acids NLLASADDSGAIKILDLENKKVIRSLKRHSNICSSVAFRPQRPQSLVSCG</p>

<p>Rabbit anti-mouse IgG1 (FITC) was raised in rabbit using murine IgG1 heavy chain as the immunogen.</p>

<p>The Ephrin-B2 antibody is a highly specialized product used in Life Sciences research. It is available as both polyclonal and monoclonal antibodies, providing researchers with a range of options for their experiments. This antibody is designed to specifically target Ephrin-B2, an important protein involved in cell signaling and development.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of CYP2W1 antibody, catalog no. 70R-10177</p>

<p>Purified recombinant Treponema pallidum TmpA protein (beta Galactosidase Fusion)</p>

<p>Mouse anti Human IgM is a monoclonal antibody that specifically targets human IgM antibodies. It is widely used in the field of life sciences for various applications, including immunohistochemistry, flow cytometry, and ELISA assays. This antibody has high affinity and specificity towards human IgM, making it an essential tool for researchers studying immune responses and antibody-mediated diseases.</p>

<p>Affinity purified Rabbit polyclonal SFMBT1 antibody</p>

<p>Rabbit polyclonal TSPAN15 antibody</p>

<p>ELAVL3 antibody was raised in Rabbit using Human ELAVL3 as the immunogen</p>

<p>The ALK antibody is a highly effective multidrug that is commonly used in immunoassays. This monoclonal antibody specifically targets the epidermal growth factor and histidine receptors, making it a versatile tool for various applications. The ALK antibody has been extensively studied and has shown excellent results in chemokine and cytotoxic assays, as well as in the detection of growth factors. It can be used in conjunction with other Polyclonal Antibodies to enhance its efficacy. The ALK antibody is activated upon binding to its target, allowing for accurate and reliable results. It is also compatible with ophthalmic formulations and can be used in colloidal or phosphatase-based assays. With its high specificity and sensitivity, the ALK antibody is an essential tool for researchers and clinicians alike.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of SNRPD1 antibody, catalog no. 70R-4701</p>

<p>CD3E antibody was raised in rabbit using the middle region of CD3E as the immunogen</p>

<p>ANXA6 antibody was raised in Rabbit using Human ANXA6 as the immunogen</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of LOC652119 antibody, catalog no. 70R-9067</p>

<p>Rabbit polyclonal SNX3 antibody (FITC)</p>

<p>The BATF antibody is a medicament that belongs to the class of antibodies. It is solubilized and isolated from retinal tissue, making it highly effective in Life Sciences research. The BATF antibody can be used in various applications, including adeno-associated virus studies, test compound analysis, and affinity ligand development. This polyclonal antibody is designed to target specific proteins or antigens of interest, allowing for precise detection and analysis. It has been widely used in the field of medicine to study autoantibodies, interleukins, adeno-associated viruses, nuclear intermediates, and other important cellular components. With its high specificity and sensitivity, the BATF antibody is an essential tool for researchers in the Life Sciences field.</p>

<p>Rabbit polyclonal TSC22D1 antibody</p>

<p>The S100A10 antibody is a powerful tool in the field of Life Sciences. It is a beta-hairpin protein that plays a crucial role as a growth factor and has been extensively studied for its antiangiogenic properties. This antibody can be used in various applications, including the development of chimeric proteins and as an anti-VEGF agent.</p>

<p>Rabbit Polyclonal IKB alpha antibody (Ser32/Ser36)</p>

<p>Purified recombinant Mouse PGAM1 Protein (His tag)</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of CDK5RAP1 antibody, catalog no. 70R-5660</p>

<p>PTPN6 antibody was raised in rabbit using the middle region of PTPN6 as the immunogen</p>

<p>1-349 amino acids: MAATAAEAVA SGSGEPREEA GALGPAWDES QLRSYSFPTR PIPRLSQSDP RAEELIENEE PVVLTDTNLV YPALKWDLEY LQENIGNGDF SVYSASTHKF LYYDEKKMAN FQNFKPRSNR EEMKFHEFVE KLQDIQQRGG EERLYLQQTL NDTVGRKIVM DFLGFNWNWI NKQQGKRGWG QLTSNLLLIG MEGNVTPAHY DEQQNFFAQI KGYKRCILFP PDQFECLYPY PVHHPCDRQS QVDFDNPDYE RFPNFQNVVG YETVVGPGDV LYIPMYWWHH IESLLNGGIT ITVNFWYKGA PTPKRIEYPL KAHQKVAIMR NIEKMLGEAL GNPQEVGPLL NTMIKGRYN</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of TNFRSF9 antibody, catalog no. 70R-10166</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of MYL9 antibody, catalog no. 70R-3669</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of WWP2 antibody, catalog no. 70R-2202</p>

<p>RGS22 antibody was raised using the N terminal of RGS22 corresponding to a region with amino acids QTVSTFSLPCCVPYNKLKSPAISSVSENFIFDDGVHPRTKKDPSKTNKLI</p>

<p>Region of TNF alpha protein corresponding to amino acids MLRSSSQNSS DKPVAHVVAN HQVEEQLEWL SQRANALLAN GMDLKDNQLV VPADGLYLVY SQVLFKGQGC PDYVLLTHTV SRFAISYQEK VNLLSAVKSP CPKDTPEGAE LKPWYEPIYL GGVFQLEKGD QLSAEVNLPK YLDFAESGQV YFGVIAL.</p>

<p>DOM3Z antibody was raised in Rabbit using Human DOM3Z as the immunogen</p>

<p>DMWD antibody was raised in Rabbit using Human DMWD as the immunogen</p>

<p>The AMPK alpha antibody is a polyclonal antibody that is used in various assays and bioassays in the field of Life Sciences. It specifically targets connexin, a protein involved in cell communication. The antibody can be used to detect autoantibodies or to study the expression and localization of connexin in different tissues or cell types. This high-quality antibody is available as both polyclonal and monoclonal antibodies, providing researchers with options for their specific needs. With its high specificity and sensitivity, this antibody is a valuable tool for studying the role of connexin and its associated pathways, such as protein kinase signaling. Its excellent performance in various applications makes it an essential component in research related to helicobacter infections, phosphocholine metabolism, and colloidal microsphere studies.</p>

<p>The GRK5 antibody is a highly effective substance used in the field of Life Sciences. It targets the protein kinase GRK5, which plays a crucial role in various biological processes. This antibody is designed to specifically bind to GRK5 and inhibit its activity, making it an invaluable tool for researchers studying signal transduction pathways and cellular signaling.</p>

<p>Rabbit polyclonal HLAB antibody (FITC)</p>

<p>Rabbit Polyclonal MKK3 antibody (Ser189)</p>

<p>Affinity purified Rabbit polyclonal BCLx antibody</p>

<p>EIF4A2 antibody was raised in Rabbit using Human EIF4A2 as the immunogen</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of HIST2H2AA3 antibody, catalog no. 70R-1604</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of GPR27 antibody, catalog no. 70R-7333</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of H2AFY antibody, catalog no. 70R-2126</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of CNN3 antibody, catalog no. 70R-9960</p>

<p>RFTN2 antibody was raised using the N terminal of RFTN2 corresponding to a region with amino acids MGCGLRKLEDPDDSSPGKIFSTLKRPQVETKTEFAYEYVLLDFTLQASSN</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of TKTL2 antibody, catalog no. 70R-2894</p>

<p>GAD65 Antibody is a highly specialized monoclonal antibody used in Life Sciences research. It specifically targets the Glutamic Acid Decarboxylase 65 (GAD65) protein, which is an important cell antigen involved in the production of gamma-aminobutyric acid (GABA). GAD65 Antibody is widely used to detect and measure GAD65 levels in human serum and other biological samples. This antibody has been extensively validated and has shown high specificity and sensitivity in detecting GAD65 autoantibodies. It can be used in various immunoassays, including ELISA, Western blotting, immunohistochemistry, and flow cytometry. With its ability to accurately detect GAD65, this antibody plays a crucial role in understanding autoimmune diseases such as type 1 diabetes and neurological disorders like epilepsy. Researchers rely on the specificity and reliability of GAD65 Antibody to advance their studies in this field.</p>

<p>The HNF4 alpha antibody is a highly specialized product used in the field of Life Sciences. It belongs to the category of monoclonal antibodies and is specifically designed to target and neutralize the HNF4 alpha protein. This protein plays a crucial role in various biological processes, including the development and function of cardiomyocytes.</p>

<p>The DLST antibody is a highly specialized product that is essential for various research and laboratory applications in the field of Life Sciences. This antibody specifically binds to DLST, which stands for Dihydrolipoamide S-Succinyltransferase, an important enzyme involved in cellular metabolism.</p>

<p>PTDSR antibody was raised in rabbit using the C terminal of PTDSR as the immunogen</p>

<p>This antibody reacts with heavy chains on human IgA (alpha chain) and.</p>

<p>Purified recombinant Human NUDT2 protein</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of B4GALT2 antibody, catalog no. 70R-6779</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of SCOTIN antibody, catalog no. 70R-5982</p>

<p>Rabbit polyclonal RPL17 antibody (FITC)</p>

<p>PGA5 antibody was raised in Mouse using a purified recombinant fragment of human PGA5 expressed in E. coli as the immunogen.</p>

<p>Rabbit polyclonal NUSAP1 antibody</p>

<p>The MASTL antibody is a highly specialized polyclonal antibody used in the field of Life Sciences. It is designed to target and bind to MASTL (microtubule-associated serine/threonine kinase-like) protein, which plays a crucial role in various cellular processes.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of MAGEA5 antibody, catalog no. 70R-4559</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of POLR3F antibody, catalog no. 70R-2962</p>

<p>Connexin 43 antibody is a glycoprotein that plays a crucial role in cell communication. It is commonly used in life sciences research as a tool to study the function of connexin proteins. This polyclonal antibody specifically targets connexin 43, which is one of the most abundant connexin isoforms found in various tissues and organs.</p>

<p>Goat anti-human IgG (Rhodamine) was raised in goat using human IgG heavy chain as the immunogen.</p>

<p>The HMGB1 antibody is a monoclonal antibody that specifically targets the high mobility group box 1 (HMGB1) protein. This protein is a growth factor that plays a crucial role in various biological processes, including inflammation and immune response. The HMGB1 antibody can be used in Life Sciences research to study the function and regulation of HMGB1.</p>

<p>TAFI antibody was raised in sheep using human TAFI purified from plasma as the immunogen.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of P2RXL1 antibody, catalog no. 70R-5077</p>

<p>Rabbit polyclonal OR13C2 antibody</p>

<p>The CAD antibody is a monoclonal antibody that specifically targets fatty acid and protein biomarkers. It is commonly used in immunoassay tests to detect the presence of these biomarkers in various samples. The reactive nature of this antibody makes it a potential biomarker for research in the Life Sciences field.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of TRIM36 antibody, catalog no. 70R-2752</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of GRSF1 antibody, catalog no. 70R-1376</p>

<p>The PUMA antibody is a powerful tool in the field of Life Sciences. It is an autoantibody that specifically targets and neutralizes the activity of PUMA (p53 upregulated modulator of apoptosis) protein. PUMA plays a crucial role in regulating cell death and is involved in various physiological processes, including embryonic development, tissue homeostasis, and immune response.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of KYNU antibody, catalog no. 70R-1261</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of ZNF670 antibody, catalog no. 70R-8103</p>