Biochemicals and Reagents

A synthetic peptide for use as a blocking control in assays to test for specificity of SLC25A20 antibody, catalog no. 70R-6485

A synthetic peptide for use as a blocking control in assays to test for specificity of UBE2N antibody, catalog no. 70R-1147

CHRNB1 antibody was raised in Rabbit using Human CHRNB1 as the immunogen

A synthetic peptide for use as a blocking control in assays to test for specificity of MFAP2 antibody, catalog no. 70R-5452

A synthetic peptide for use as a blocking control in assays to test for specificity of XAGE2 antibody, catalog no. 70R-9927

Monobiotin is a ligand-gated ion channel that prevents calcium ions from entering the cell. It is also a protein interaction inhibitor and can be used to study receptor-ligand interactions. Monobiotin binds to the extracellular domain of the ligand-gated ion channel INSL6, preventing it from opening and preventing calcium ions from entering the cell. This inhibition leads to decreased production of nitric oxide (NO) in activated macrophages and reduced vascular permeability in endothelial cells. Monobiotin is also an antibody activator, which can be used to activate immune cells by binding to a specific antibody on the surface of immune cells. The monobiotin-antibody complex then activates the immune response by triggering further activation of other immune cells such as cytotoxic T lymphocytes or natural killer cells.

A synthetic peptide for use as a blocking control in assays to test for specificity of Ndufv2 antibody, catalog no. 70R-9509

Rabbit polyclonal ARAF antibody (Ser299)

Prolactin Mouse is a cell-based assay that detects apoptosis-inducing factor in the cell culture. Prolactin Mouse is a homogenous, fluorescence-based assay that can be used to study the effects of drugs on cell growth and apoptosis. The protocol involves adding prolactin mouse cells to a 96-well plate, incubating the cells at 37°C for 2 hours, and then adding an agent to induce apoptosis. The cells are then incubated for 24 hours at 37°C with 5% CO2. After this time, the cells are stained with Annexin V and 7AAD antibodies, which bind to phosphatidylserine (PS) on the outer leaflet of the plasma membrane. These antibodies form a complex with PS that can be detected by flow cytometry or microscopy after staining with fluorescent dyes. Prolactin Mouse can also be used for treatments such as endometriosis and mitogen-activated protein kinase

A synthetic peptide for use as a blocking control in assays to test for specificity of CHSY-2 antibody, catalog no. 70R-6580

DISP1 antibody was raised in Rabbit using Human DISP1 as the immunogen

BD1 antibody was raised in rabbit using highly pure recombinant human BD-1 as the immunogen.

GUCY1A3 antibody was raised in Rabbit using Human GUCY1A3 as the immunogen

Hydroxy-bifenthrin is an analog of bifenthrin, a synthetic pyrethroid insecticide. However, it has been found to have medicinal properties as an anticancer agent. Hydroxy-bifenthrin has been shown to induce apoptosis in cancer cells and inhibit tumor growth. It does this by acting as a kinase inhibitor, disrupting the cell cycle and preventing the production of proteins necessary for cancer cell survival. In addition, hydroxy-bifenthrin has been found in human urine samples, indicating that it may be metabolized in the body and excreted through the kidneys. This promising compound is currently being studied for its potential use in cancer treatment.

A synthetic peptide for use as a blocking control in assays to test for specificity of NUDT16L1 antibody, catalog no. 70R-1265

Zoledronic acid monohydrate EP Impurity B is a chemical impurity often encountered in the synthesis and quality control of zoledronic acid. This impurity arises from synthetic pathways involved in the production of bisphosphonates, a class of compounds used for bone-related conditions. As an impurity, it does not have direct therapeutic action but plays a significant role in the characterization and purity assessment of pharmaceutical formulations.

Affinity purified Rabbit polyclonal Scramblase 1 antibody

A synthetic peptide for use as a blocking control in assays to test for specificity of RBM9 antibody, catalog no. 70R-4826

The JAK1 antibody is a highly effective chemokine inhibitor that has cytotoxic properties. It works by binding to the glucagon acid complex, preventing the activation of receptors and inhibiting cell signaling. This monoclonal antibody is specifically designed to target JAK1, a key protein involved in immune response and inflammation. By blocking the receptor binding, it prevents the release of pro-inflammatory cytokines and reduces inflammation in various tissues. The JAK1 antibody is widely used in life sciences research and has shown promising results in treating autoimmune diseases and certain types of cancer. Its high specificity and affinity make it an excellent tool for studying protein-protein interactions and developing targeted therapies.

A synthetic peptide for use as a blocking control in assays to test for specificity of ZADH2 antibody, catalog no. 70R-4445

FBXL16 antibody was raised using the middle region of FBXL16 corresponding to a region with amino acids GCPLLTTTGLSGLVQLQELEELELTNCPGATPELFKYFSQHLPRCLVIE

Affinity purified Chicken polyclonal Beta Tubulin 3 antibody

The p73 antibody is a highly specialized polyclonal antibody used in the field of Life Sciences. It is designed to specifically target and bind to the p73 protein, which plays a crucial role in various cellular processes including cell growth, differentiation, and apoptosis. This antibody has been extensively tested and validated for its high specificity and sensitivity.

A synthetic peptide for use as a blocking control in assays to test for specificity of STK39 antibody, catalog no. 70R-1017

A synthetic peptide for use as a blocking control in assays to test for specificity of SSBP3 antibody, catalog no. 70R-3561

The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is an antituberculosis drug that falls under the class of rifamycins. It is highly effective in treating tuberculosis infections and contains active compounds that exhibit bactericidal activity. The drug works by binding to DNA-dependent RNA polymerase, preventing transcription and replication, thus inhibiting bacterial growth. Its efficacy has been demonstrated through patch-clamp technique on human erythrocytes. The drug undergoes various metabolic transformations, including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, it specifically targets markers expressed in Mycobacterium tuberculosis strains and inhibits cell growth in culture.

Rabbit polyclonal RAB3C antibody

The RFX2 antibody is a highly specialized monoclonal antibody used in Life Sciences research. It specifically targets and binds to insulin, making it an essential tool for studying insulin-related processes. This antibody recognizes the tyrosine residues on insulin molecules, allowing for precise detection and analysis.

The HSL antibody is a monoclonal antibody that specifically targets and inhibits the activity of phosphatase enzymes. This antibody is widely used in Life Sciences research to study the role of phosphatases in various cellular processes. It has been shown to effectively block the activity of phosphatases involved in signal transduction pathways, such as those activated by growth factors and cytokines like TNF-α and chemokines.

OTS514 hydrochloride is an analog inhibitor of adenosine triphosphate (ATP)-competitive kinase, which has been shown to exhibit potent anticancer activity. It selectively inhibits the activity of the serine/threonine kinase AKT1, which is involved in regulating cell growth and survival. OTS514 hydrochloride has been found to induce apoptosis in various human cancer cell lines, including those from breast, colon, and lung cancers. It also exhibits inhibitory effects on polysaccharides that promote tumor growth in Chinese hamster urine. This compound has shown promising results as a potential therapeutic agent for cancer treatment.

A synthetic peptide for use as a blocking control in assays to test for specificity of CACNG4 antibody, catalog no. 70R-1535

D2HGDH antibody was raised in Rabbit using Human D2HGDH as the immunogen

CXCL3 antibody was raised in Rabbit using Human CXCL3 as the immunogen

Rat thrombocyte antibody was raised in rabbit using rat thrombocytes as the immunogen.

The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug from the rifamycin class. It is known for its bactericidal activity against tuberculosis infection. By binding to DNA-dependent RNA polymerase, it inhibits bacterial growth, preventing transcription and replication. This drug has been extensively studied and shown to be highly effective using advanced techniques such as the patch-clamp technique on human erythrocytes. It undergoes various metabolic transformations, including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, it specifically targets markers expressed in Mycobacterium tuberculosis strains and inhibits cell growth in culture.

Chondroitin-6 sulfate antibody was raised in mouse using chondroitinase ABC-digested adult human aggrecan as the immunogen.

NS4 region of Hepatitis C Virus protein.

A synthetic peptide for use as a blocking control in assays to test for specificity of ODF4 antibody, catalog no. 70R-6942

DNP-Pro-Leu-Gly-Ile-Ala-Gly-Arg-NH₂ is a peptide that belongs to the class of activator. It facilitates the interaction between antibodies and their corresponding antigens, which is important for the immune system. DNP-Pro-Leu-Gly-Ile-Ala-Gly-Arg possesses high purity and can be used as a research tool in Cell Biology, Immunology, and Pharmacology. This peptide has been shown to inhibit the activity of ion channels by binding to them and preventing ions from passing through.

A synthetic peptide for use as a blocking control in assays to test for specificity of ZNFN1A5 antibody, catalog no. 70R-7977

A synthetic peptide for use as a blocking control in assays to test for specificity of Coro2b antibody, catalog no. 70R-9147

A synthetic peptide for use as a blocking control in assays to test for specificity of MCM8 antibody, catalog no. 70R-5605

A synthetic peptide for use as a blocking control in assays to test for specificity of SLA/LP antibody, catalog no. 70R-4725

A synthetic peptide for use as a blocking control in assays to test for specificity of EIF3G antibody, catalog no. 70R-4993

Affinity purified Rabbit polyclonal MDH2 antibody

Affinity purified Rabbit polyclonal YIPF4 antibody

Rabbit polyclonal TR19L antibody

AIP-III is a peptide that belongs to the group of activators. It binds to the nicotinic acetylcholine receptor, thereby activating it. AIP-III has been shown to cause significant changes in the activity of ion channels and is used as a research tool for pharmacology and protein interactions. AIP-III has been found to be a potent inhibitor of various types of cancer cells in cell culture experiments, although its effects on humans are unknown.

NPDC1 antibody was raised using the N terminal of NPDC1 corresponding to a region with amino acids MATPLPPPSPRHLRLLRLLLSGLVLGAALRGAAAGHPDVAACPGSLDCAL

Tetanus toxin antibody is a monoclonal antibody that specifically targets and neutralizes the tetanus toxin. This antibody is derived from alpha-fetoprotein and has been extensively studied in the field of Life Sciences. It binds to the tetanus toxin, preventing it from binding to its target receptors and exerting its toxic effects. Additionally, this antibody has been shown to inhibit the activity of TGF-beta, a growth factor involved in various cellular processes. The binding proteins present in this antibody can effectively block the interaction between TGF-beta and its receptors, leading to the inhibition of downstream signaling pathways. Furthermore, studies have demonstrated that this monoclonal antibody can also bind to autoantibodies and other proteins involved in disease progression. With its high specificity and efficacy, tetanus toxin antibody holds great potential for therapeutic applications in various medical conditions.

A synthetic peptide for use as a blocking control in assays to test for specificity of NDST3 antibody, catalog no. 70R-7320

Rad9 antibody is a monoclonal antibody that specifically binds to Rad9, a protein involved in DNA damage response and repair. This antibody has been shown to be highly effective in detecting Rad9 in various biological samples, including pleural fluid and human serum. It can be used for research purposes in the field of life sciences to study the role of Rad9 in cellular processes such as DNA repair, cell cycle regulation, and apoptosis. Additionally, Rad9 antibody has antiangiogenic properties and can inhibit endothelial growth by binding to specific receptors on endothelial cells. Its cytotoxic effects make it a promising candidate for targeted cancer therapy. With its high specificity and affinity for Rad9, this antibody is an invaluable tool for scientists studying biomolecules and their interactions.

The proGRP antibody is a highly specialized antibody used in the field of Life Sciences. It is designed to specifically target and immobilize the proGRP protein, which plays a crucial role in various biological processes. This antibody is produced using both monoclonal and polyclonal antibodies, ensuring high specificity and sensitivity.

Pneumocystis carinii antibody was raised in mouse using Pneumocystis carinii isolates as the immunogen.

ACTRT1 antibody was raised using the middle region of ACTRT1 corresponding to a region with amino acids DTDIQNKLYADIVLSGGTTLLPGLEERLMKEVEQLASKGTPIKITASPDR

The RASGRP4 antibody is a highly effective medicament that targets the circumsporozoite protein. This antibody specifically binds to the activated form of the protein, which is located in the nucleus. It has been shown to inhibit the activity of VEGF-C, human chorionic gonadotropin, and other antigens involved in angiogenesis. The RASGRP4 antibody can be used in immunohistochemistry studies to detect and visualize these proteins in various tissues. This product is a polyclonal antibody, meaning it is derived from multiple sources and provides a broad range of specificity. It is widely used in life sciences research to study endothelial growth factors and their role in various biological processes. With its high-quality performance and reliable results, this antibody is an essential tool for scientists and researchers working in the field of molecular biology.

A synthetic peptide for use as a blocking control in assays to test for specificity of FAM62B antibody, catalog no. 70R-6901

Affinity purified Rabbit polyclonal NDUFAB1 antibody

ADH-503 is a small-molecule drug that is used as an anti-cancer agent. It inhibits tumor growth by targeting the mitochondria and microenvironment. ADH-503 has been shown to inhibit tumor cells in vitro and in vivo through various mechanisms, such as inhibiting the production of growth factors, reducing reactive oxygen species (ROS) levels, and inhibiting angiogenesis. In addition, ADH-503 has been shown to be effective against chronic viral infections and cancer cells with mitochondrial DNA mutations. Clinical studies have demonstrated that ADH-503 can reduce the incidence of myeloid-derived suppressor cells (MDSCs) in patients with acute myeloid leukemia (AML).

Rabbit polyclonal TUSC5 antibody

A synthetic peptide for use as a blocking control in assays to test for specificity of Ankrd13d antibody, catalog no. 70R-9367

The USP15 antibody is a trifunctional antibody that has multiple applications in the field of Life Sciences. This antibody specifically targets and binds to USP15, which is an enzyme involved in the regulation of various cellular processes. The USP15 antibody can be used for research purposes, such as studying the role of USP15 in different signaling pathways or investigating its interaction with other proteins.

EDN1 antibody was raised in Rabbit using Human EDN1 as the immunogen

A synthetic peptide for use as a blocking control in assays to test for specificity of IDI1 antibody, catalog no. 70R-3705

The Keratin 19 antibody is a highly specialized monoclonal antibody that targets the growth factor Keratin 19. It is commonly used in Life Sciences research for various applications such as hybridization studies, high-affinity glucose binding assays, and polymerase chain reactions (PCR). This antibody can also be utilized in the development of polymeric micelles for drug delivery systems and as a tool in gene therapy using adeno-associated virus vectors. Additionally, the Keratin 19 antibody has been shown to play a role in preventing deprivation-induced apoptosis by targeting molecular pathways involved in cell survival. Its specificity towards Keratin 19 makes it an ideal tool for studying sugar transport mechanisms, collagen synthesis, and the effects of compounds like okadaic acid on cellular processes. With its exceptional affinity and versatility, the Keratin 19 antibody is an invaluable asset for researchers exploring a wide range of molecular targets in their scientific investigations.

A synthetic peptide for use as a blocking control in assays to test for specificity of ERCC5 antibody, catalog no. 70R-3326

Affinity purified Rabbit polyclonal alpha SNAP antibody

A synthetic peptide for use as a blocking control in assays to test for specificity of Smpdl3a antibody, catalog no. 70R-9153

A synthetic peptide for use as a blocking control in assays to test for specificity of MARVELD2 antibody, catalog no. 70R-6334

Rat anti-mouse IgA (biotin) was raised in rat using murine IgA as the immunogen.

The PSAP antibody is a growth factor antigen that plays a crucial role in various biological processes. It is an essential tool in the field of Life Sciences, particularly in antibody research. The PSAP antibody is available in both polyclonal and monoclonal forms, providing researchers with options to suit their specific needs.

A synthetic peptide for use as a blocking control in assays to test for specificity of ARL8B antibody, catalog no. 70R-3486

GBA3 antibody was raised in Rabbit using Human GBA3 as the immunogen

QTRT1 antibody was raised using a synthetic peptide corresponding to a region with amino acids KDKPRYLMGVGYATDLVVCVALGCDMFDCVFPTRTARFGSALVPTGNLQL

A synthetic peptide for use as a blocking control in assays to test for specificity of ZNF131 antibody, catalog no. 70R-8709

A synthetic peptide for use as a blocking control in assays to test for specificity of ATP6V1B2 antibody, catalog no. 70R-2661

Please enquire for more information about Human Retinol Binding Protein ELISA Kit including the price, delivery time and more detailed product information at the technical inquiry form on this page

Horse IgG (H + L) purified protein

CD40 antibody is a monoclonal antibody used in Life Sciences for various applications. It specifically targets CD40, a cell surface receptor involved in immune responses. This antibody can activate human endothelial cells and has been shown to have antiangiogenic properties, reducing microvessel density. CD40 antibody can be used in combination with other therapies for antiangiogenic therapy. Additionally, it has been used in DNA vaccine studies to enhance the immune response by targeting antigenic peptides. CD40 antibody has also been found to inhibit the production of tumor necrosis factor-alpha (TNF-α), which plays a role in inflammation and immune response regulation.

A synthetic peptide for use as a blocking control in assays to test for specificity of VAT1 antibody, catalog no. 70R-4508

A synthetic peptide for use as a blocking control in assays to test for specificity of SP1 antibody, catalog no. 20R-1138

A synthetic peptide for use as a blocking control in assays to test for specificity of EIF3EIP antibody, catalog no. 70R-4419

Rabbit polyclonal T3JAM antibody

A synthetic peptide for use as a blocking control in assays to test for specificity of LYPD6 antibody, catalog no. 70R-5418

The IL4 antibody is a highly specialized product used in the field of Life Sciences. It is an essential tool for researchers studying various aspects of immunology and molecular biology. This antibody specifically targets interleukin-4 (IL-4), a cytokine involved in immune responses and inflammation.

A synthetic peptide for use as a blocking control in assays to test for specificity of PDCD7 antibody, catalog no. 70R-6012

A synthetic peptide for use as a blocking control in assays to test for specificity of C21orf45 antibody, catalog no. 70R-3295

A synthetic peptide for use as a blocking control in assays to test for specificity of LYPD5 antibody, catalog no. 70R-4270

Affinity purified Rabbit polyclonal Beta ETF antibody

Affinity purified Rabbit polyclonal FAM9B antibody

A synthetic peptide for use as a blocking control in assays to test for specificity of MTMR1 antibody, catalog no. 70R-1275

A synthetic peptide for use as a blocking control in assays to test for specificity of TMED10 antibody, catalog no. 70R-7250

HSPA8 antibody was raised in Rabbit using Human HSPA8 as the immunogen

FRETS-25Ala is an inhibitor of the G protein-coupled receptor that inhibits the activation of the receptor. It is a peptide with a molecular weight of 1206.5 Da and a purity of 99.2%. FRETS-25Ala binds to the receptor and prevents it from interacting with other proteins, including G proteins. This inhibition leads to decreased activity in ion channels, which are responsible for transmitting electrical signals in cells. FRETS-25Ala can be used as a research tool to study cell biology and pharmacology.

A synthetic peptide for use as a blocking control in assays to test for specificity of CD8A antibody, catalog no. 70R-9677

CD8a antibody was raised in Mouse using the alpha chainc of chicken CD8 as the immunogen.

CES3 antibody was raised in rabbit using the C terminal of CES3 as the immunogen

A synthetic peptide for use as a blocking control in assays to test for specificity of CARS antibody, catalog no. 70R-5004

A synthetic peptide for use as a blocking control in assays to test for specificity of CHST6 antibody, catalog no. 70R-5371

Purified native Epidemic Diarrhea of Infant Mice virus protein

A synthetic peptide for use as a blocking control in assays to test for specificity of SFRS10 antibody, catalog no. 70R-1421

Chlamydia trachomatis antibody (FITC) was raised in rabbit using L2 and other serovar groups as the immunogen.

Purified recombinant Human TNFRSF17 protein (His tag)

Goat IgG Fab is a purified immunoglobulin that is used in Life Sciences research. It is a monoclonal antibody that specifically targets and neutralizes various molecules, including collagen, TGF-beta, dopamine, interferon, and glutamate. This versatile antibody can be used in various applications, such as ELISA assays, western blotting, immunohistochemistry, and flow cytometry. Goat IgG Fab has high affinity and specificity for its target molecules, making it an essential tool for studying protein-protein interactions and signaling pathways. Additionally, it can be used to block the activity of growth factors and cytokines in cell culture experiments. With its exceptional performance and reliability, Goat IgG Fab is a valuable asset for researchers in the field of Life Sciences.

Affinity purified Rabbit polyclonal CRHSP24 antibody

A synthetic peptide for use as a blocking control in assays to test for specificity of TACC3 antibody, catalog no. 70R-4547

CX3CL1 antibody was raised in Rabbit using Human CX3CL1 as the immunogen

SCD antibody was raised using a synthetic peptide corresponding to a region with amino acids HPAVKEKGSTLDLSDLEAEKLVMFQRRYYKPGLLMMCFILPTLVPWYFWG

Please enquire for more information about Human IgA ELISA Kit including the price, delivery time and more detailed product information at the technical inquiry form on this page

A synthetic peptide for use as a blocking control in assays to test for specificity of MSRA antibody, catalog no. 70R-3994

A synthetic peptide for use as a blocking control in assays to test for specificity of FAM83E antibody, catalog no. 70R-3875

ANXA10 antibody was raised in Rabbit using Human ANXA10 as the immunogen

The Androgen Receptor antibody is a powerful tool in the field of Life Sciences. It is a monoclonal antibody specifically designed to target the androgen receptor, a steroid receptor protein that plays a crucial role in mediating the effects of androgens in various biological processes. This antibody can be used for a wide range of applications, including immunoassays, neutralizing experiments, and as a probe for detecting the presence of the androgen receptor.

CD9 antibody was raised in mouse using human CD9 as the immunogen.

CD62L antibody (Allophycocyanin-CY7) was raised in rat using C3H/eb cloned murine B lymphoma 38C-13 as the immunogen.

Mucin is majorly composed of carbohydrate units, the monomer of mucin being about 640 kDa.

EIF2A antibody was raised in Rabbit using Human EIF2A as the immunogen

A synthetic peptide for use as a blocking control in assays to test for specificity of SUMO3 antibody, catalog no. 70R-3146

PTCH1 antibody was raised in rabbit using residues 269-279 [KKINYQVDSWE] of the murine PTCH protein as the immunogen.

PGK1 antibody was raised using the C terminal of PGK1 corresponding to a region with amino acids ATVASGIPAGWMGLDCGPESSKKYAEAVTRAKQIVWNGPVGVFEWEAFAR

Rabbit anti Mouse IgM is a monoclonal antibody that belongs to the category of antibodies. It is specifically designed to target and bind to mouse IgM, making it an essential tool for various research applications in the field of Life Sciences. This antibody can be used for studying the role of IgM in different biological processes such as anti-VEGF (vascular endothelial growth factor) therapy, adiponectin signaling, β-catenin regulation, and more. Additionally, Rabbit anti Mouse IgM can be utilized for detecting specific proteins like human chorionic gonadotropin (hCG), alpha-synuclein, epidermal growth factor (EGF), c-myc, and glycopeptides. Its binding ability allows researchers to explore these proteins' functions and interactions within cellular pathways. Furthermore, this antibody has been shown to induce Fas-mediated apoptosis in certain experimental settings. With its high specificity and versatility, Rabbit anti Mouse IgM is an invaluable tool for advancing scientific

Rabbit polyclonal SMARCD2 antibody

Rabbit polyclonal GABRA1 antibody (N-Terminus)

RPL9 antibody was raised using the C terminal of RPL9 corresponding to a region with amino acids ELILEGNDIELVSNSAALIQQATTVKNKDIRKFLDGIYVSEKGTVQQADE

A synthetic peptide for use as a blocking control in assays to test for specificity of SMYD1 antibody, catalog no. 70R-8197

A synthetic peptide for use as a blocking control in assays to test for specificity of CCR5 antibody, catalog no. 70R-7848

The PRKACB antibody is a highly specific antibody that targets the protein kinase A catalytic subunit beta (PRKACB). This antibody is derived from a vaccine strain and has been extensively tested for its antigen specificity. It has shown high affinity and selectivity for PRKACB, making it an ideal tool for studying the function and regulation of this protein.

ELISA kit for detection of Cystatin C in the research laboratory

Affinity purified Rabbit polyclonal B-cell linker protein antibody

A synthetic peptide for use as a blocking control in assays to test for specificity of EEF1G antibody, catalog no. 70R-2756

Ebastine-d5 is a selective inhibitor of the histamine H1 receptor. It binds to the ligand binding site of the H1 receptor and blocks the activity of this receptor. This drug has been shown to be an effective treatment for allergic rhinitis, chronic urticaria, and other allergic conditions. Ebastine-d5 is used in research as a tool to study protein interactions and receptor function.

A synthetic peptide for use as a blocking control in assays to test for specificity of SSTR1 antibody, catalog no. 70R-9812

Human sequence expressed in HEK-293 Cells; purity >90% by SDS-PAGE and analyzed by silver stain; C-terminal 6-His Tag.

GSTP1 antibody was raised using the N terminal of GSTP1 corresponding to a region with amino acids TVETWQEGSLKASCLYGQLPKFQDGDLTLYQSNTILRHLGRTLGLYGKDQ

A synthetic peptide for use as a blocking control in assays to test for specificity of MAP4K2 antibody, catalog no. 70R-5784

The SDC3 antibody is a highly specialized antibody that targets the nuclear receptor SDC3. It is available in both polyclonal and monoclonal forms, offering versatility for various research applications in the field of Life Sciences. This antibody specifically recognizes SDC3 and can be used to study its role in different biological processes.

A synthetic peptide for use as a blocking control in assays to test for specificity of OTUB1 antibody, catalog no. 70R-3802

ILS-920 is a neurotrophic protein inhibitor that inhibits the nicotinic acetylcholine receptor (nAChR) and thrombin receptor. It blocks the binding of ligands to their receptors, thereby inhibiting cell signaling. ILS-920 has been shown to protect against neuronal death in a variety of cancer models. This substance also inhibits the growth of cultured cells and can be used as a potential therapeutic agent for treating cancer and neurodegenerative diseases.

Affinity purified Rabbit polyclonal TNF beta antibody

Affinity purified Rabbit polyclonal KHS antibody

The PFKFB3 antibody is a highly specialized tool used in the field of Life Sciences. It belongs to the category of Polyclonal Antibodies and is designed to target and bind to specific proteins associated with PFKFB3. This antibody can be used in various applications such as solid phase assays, histidine quantitation, and messenger RNA analysis.

A synthetic peptide for use as a blocking control in assays to test for specificity of METTL6 antibody, catalog no. 70R-2973

Region of SLIT2 N protein corresponding to amino acids QACPAQCSCS GSTVDCHGLA LRSVPRNIPR NTERLDLNGN NITRITKTDF AGLRHLRVLQ LMENKISTIE RGAFQDLKEL ERLRLNRNHL QLFPELLFLG TAKLYRLDLS ENQIQAIPRK AFRGAVDIKN LQLDYNQISC IEDGAFRALR DLEVLTLNNN NITRLSVASF NHMPKLRTFR LHSNNLYCDC HLAWLSDWLR QRPRVGLYTQ CMGPSHLRGH NVAEVQKREF VCSGHQSFMA PSCSVLHCPA ACTCSNNIVD CRGKGLTEIP TNLPETITEI RLEQNTIKVI PPGAFSPYKK LRRIDLSNNQ ISELAPDAFQ GLRSLNSLVL YGNKITELPK SLFEGLFSLQ LLLLNANKIN CLRVDAFQDL HNLNLLSLYD NKLQTIAKGT FSPLRAIQTM HLAQNPFICD CHLKWLADYL HTNPIETSGA RCTSPRRLAN KRIGQIKSKK FRCSAKEQYF IPGTEDYRSK LSGDCFADLA CPEKCRCEGT TVDCSNQKLN KIPEHIPQYT AELRLNNNEF TVLEATGIFK KLPQLRKINF SNNKITDIEE GAFEGASGVN EILLTSNRLE NVQHKMFKGL ESLKTLMLRS NRITCVGNDS FIGLSSVRLL SLYDNQITTV APGAFDTLHS LSTLNLLANP FNCNCYLAWL GEWLRKKRIV TGNPRCQKPY FLKEIPIQDV AIQDFTCDDG NDDNSCSPLS RCPTECTCLD TVVRCSNKGL KVLPKGIPRD VTELYLDGNQ FTLVPKELSN YKHLTLIDLS NNRISTLSNQ SFSNMTQLLT LILSYNRLRC IPPRTFDGLK SLRLLSLHGN DISVVPEGAF NDLSALSHLA IGANPLYCDC NMQWLSDWVK SEYKEPGIAR CAGPGEMADK LLLTTPSKKF TCQGPVDVNI LAKCNPCLSN PCKNDGTCNS DPVDFYRCTC PYGFKGQDCD VPIHACISNP CKHGGTCHLK EGEEDGFWCI CADGFEGENC EVNVDDCEDN DCENNSTCVD GINNYTCLCP PEYTGELCEE KLDFCAQDLN PCQHDSKCIL TPKGFKCDCT PGYVGEHCDI DFDDCQDNKC KNGAHCTDAV NGYTCICPEG YSGLFCEFSP PMV.

A synthetic peptide for use as a blocking control in assays to test for specificity of DDX6 antibody, catalog no. 70R-8177

A synthetic peptide for use as a blocking control in assays to test for specificity of NR1I3 antibody, catalog no. 70R-2541

The TRPC3 antibody is a powerful tool for researchers in the field of Life Sciences. It specifically targets and binds to the epidermal growth factor, which is known to play a crucial role in various cellular processes. This antibody can be used to detect activated epidermal growth factor and has been extensively studied for its ability to inhibit protease activity.

A synthetic peptide for use as a blocking control in assays to test for specificity of PRMT2 antibody, catalog no. 70R-1038

Rabbit polyclonal GAP43 antibody (Ser41)

A synthetic peptide for use as a blocking control in assays to test for specificity of Dusp19 antibody, catalog no. 70R-9185

The IGF-1R antibody is a powerful tool in the field of Life Sciences. It specifically targets the insulin-like growth factor-1 receptor, an important protein involved in cell growth and development. This antibody can be used in various research applications, including immunofluorescence, Western blotting, and immunohistochemistry.

AGFG2 antibody was raised in Rabbit using Human AGFG2 as the immunogen

Affinity purified Rabbit polyclonal PPP3CB antibody

A synthetic peptide for use as a blocking control in assays to test for specificity of CCNB3 antibody, catalog no. 70R-8395

A synthetic peptide for use as a blocking control in assays to test for specificity of OMG antibody, catalog no. 70R-6385

Brr2 inhibitor C9 is an antibody that blocks the activation of the Brr2 protein by binding to it. This antibody is a research tool that can be used in cell biology and pharmacology studies, as well as for the study of protein interactions and receptor ligands. The antibody has been shown to increase the amplitude of calcium-dependent currents in cultured rat neurons. It also inhibits voltage-gated potassium channels and enhances GABAergic transmission. This product is high purity, with a purity level of 98%.

A synthetic peptide for use as a blocking control in assays to test for specificity of CUGBP2 antibody, catalog no. 70R-4819

C20ORF3 antibody was raised using the N terminal Of C20Orf3 corresponding to a region with amino acids EPPLLLGVLHPNTKLRQAERLFENQLVGPESIAHIGDVMFTGTADGRVVK

ML095 hydrochloride is a phosphatase inhibitor that has shown anti-tumour activity in vitro and in vivo. It inhibits the enzyme placental alkaline phosphatase (PLAP) by binding to it, thereby preventing the removal of phosphate groups from substrates. This leads to an accumulation of substrate molecules, which may have an effect on cell signalling pathways and biological functions such as cell proliferation and migration. ML095 hydrochloride has been shown to modulate cancer cell growth in vitro and in vivo. This molecule also inhibits the activity of other phosphatases including pancreatic, testicular, and intestinal enzymes.
The compound is a potent inhibitor of bladder cancer cell growth in vitro and in vivo, as well as bladder carcinoma cells that express high levels of PLAP. The compound has been shown to be safe for use by children with cancer or those who have undergone surgery for bladder cancer at doses up to 10 mg/kg body weight.

A synthetic peptide for use as a blocking control in assays to test for specificity of VPS16 antibody, catalog no. 70R-9524

A synthetic peptide for use as a blocking control in assays to test for specificity of SCGB1A1 antibody, catalog no. 70R-5399

A synthetic peptide for use as a blocking control in assays to test for specificity of LDHAL6B antibody, catalog no. 70R-3958

A synthetic peptide for use as a blocking control in assays to test for specificity of RGS13 antibody, catalog no. 70R-1144

OAT antibody was raised in mouse using recombinant human OAT (33-439aa) purified from E.coli as the immunogen.

The p73 antibody is a highly effective and versatile tool in the field of Life Sciences. This colloidal, activated antibody is known for its exceptional inhibitory properties against interleukin-6 (IL-6), a key pro-inflammatory cytokine. By neutralizing IL-6, the p73 antibody helps regulate immune responses and reduce inflammation.

Affinity purified Rabbit polyclonal RAB6A antibody

Methamphetamine antibody was raised in mouse using methamphetamine-BSA as the immunogen.

Nidogen-1 is a host cell protein (HCP) generated by CHO cells during production of biotherapeutics. This process-related impurity accumulates in the extracellular space as it is released from dead CHO cells and secreted from viable cells during cell culture. Nidogen-1 interacts with the Fc region of therapeutic monoclonal antibodies and is particularly difficult contaminant to remove even after polishing steps.

AZ506 is a peptide that was originally isolated from the venom of the North American scorpion Centruroides suffusus. The peptide has been shown to act as an agonist at the α7 nicotinic acetylcholine receptor, and it has been used in research for its ability to inhibit voltage-gated potassium channels.

Please enquire for more information about 2-Butyl-2-(2,4-dichlorophenyl)oxirane including the price, delivery time and more detailed product information at the technical inquiry form on this page