Biochemicals and Reagents

MRS-1706 is a compound that inhibits the effect of ATP on P2Y receptors. MRS-1706 has been shown to be effective in reducing inflammation and suppressing the proliferation of cells, which are associated with primary sclerosing cholangitis (PSC). The drug also has an inhibitory effect on adenosine production by affecting the mitochondrial membrane potential and Ca2+ overload. MRS-1706 can reduce camp levels, inhibit receptor activity and increase gamma-aminobutyric acid levels, leading to decreased cellular proliferation. MRS-1706 also binds to A3 adenosine receptors, which leads to a reduction in cell proliferation.

CD8a antibody (biotin) was raised in mouse using trhe alpha chain of chicken CD8 as the immunogen.

CD18 antibody was raised in Mouse using a purified recombinant fragment of CD18 expressed in E. coli as the immunogen.

A synthetic peptide for use as a blocking control in assays to test for specificity of PPP4R2 antibody, catalog no. 70R-3940

Ricasetron is a type of serotonin receptor antagonist that is used to prevent nausea and vomiting caused by certain types of chemotherapy, which are known as emetogenic. Ricasetron is an ion-pair reconstituted drug that binds to the 5-HT4 receptor in the gastrointestinal tract. This prevents serotonin from binding to the receptor, preventing nausea and vomiting. Ricasetron has also been shown to decrease appetite, which may be due to its effects on neurokinin-1 (NK1). Ricasetron has been clinically proven for use in patients with cancer who are receiving chemotherapy.
Ricasetron is a type of fatty acid that is used as a chemical structure in various medications. It was first synthesized in 1972 by scientists at Sandoz Pharmaceuticals AG and was patented in 1974.

A synthetic peptide for use as a blocking control in assays to test for specificity of FBXO10 antibody, catalog no. 70R-3607

J61 is a fatty acid with cytotoxic activity against tumefaciens-mediated transformation of HL-60 cells and K562 cells. It has been shown to have significant cytotoxicity against myeloid leukemia cell lines. J61 has been shown to induce apoptosis by activating the cation channel, which in turn leads to an increase in intracellular calcium levels, causing activation of the polymerase chain reaction and hemolytic activity. J61 has also been shown to inhibit the growth of certain bacteria by binding to the surface membrane receptor and inducing expression of colony-stimulating factor. The antibodies that are produced bind specifically to these receptors on the surface of certain cancer cells, leading to an increased cytotoxic response.

Streptococcus group A antibody (biotin) was raised in rabbit using group A Streptococci as the immunogen.

A synthetic peptide for use as a blocking control in assays to test for specificity of CDC42EP5 antibody, catalog no. 70R-3748

Affinity purified Rabbit polyclonal GEM antibody

CD19 antibody (Allophycocyanin) was raised in rat using murine CD19-expressing K562 human erythroleukemia cells as the immunogen.

KB03-SLF is a heterobifunctional cross-linker that can be used for covalent labeling of ubiquitin in cells. KB03-SLF reacts with the side chain of lysine residues on ubiquitin protein and is able to form covalent bonds with amino groups on proteins. The reaction between KB03-SLF and ubiquitin is catalyzed by e3 ligase, which is responsible for the removal of ubiquitin from polyubiquitinated proteins. This reaction will lead to proteolysis and degradation of the polyubiquitinated protein. Using this method, KB03-SLF can be used as a degrader in proteomic experiments.

Selective indoleamine 2,3-dioxygenase 1 (IDO1) inhibitor

A synthetic peptide for use as a blocking control in assays to test for specificity of MSL2L1 antibody, catalog no. 70R-2100

A synthetic peptide for use as a blocking control in assays to test for specificity of DDX39 antibody, catalog no. 70R-1399

The HAO1 antibody is a monoclonal antibody that specifically targets and binds to the HAO1 protein. This antibody has been extensively studied in the field of life sciences and has shown promising results in various applications.

CD86 antibody (Spectral Red) was raised in rat using murine CD86 as the immunoge.

CD4 antibody (Allophycocyanin) was raised in mouse using human CD4 as the immunoge.

A synthetic peptide for use as a blocking control in assays to test for specificity of HP antibody, catalog no. 70R-5419

LY518674 is a small-molecule inhibitor of protein tyrosine phosphatase 1B (PTP1B) that has been shown to be effective in animal models of atherosclerosis and insulin resistance. LY518674 binds to the active site of PTP1B and inhibits its activity by binding to the phosphate group of ATP, which is required for the activation of PTP1B. LY518674 has also been shown to increase glucose uptake in skeletal muscle cells. The compound has not been tested in humans yet but it is anticipated that it will have a similar effect on human cells as it does on animal cells. LY518674 may be used as an oral treatment for metabolic disorders such as obesity and diabetes.

A synthetic peptide for use as a blocking control in assays to test for specificity of KCTD4 antibody, catalog no. 70R-5093

Affinity purified Rabbit polyclonal CHEK2 antibody

Purified recombinant Human DNAJB4 protein (His tag)

Rabbit polyclonal UGDH antibody

A synthetic peptide for use as a blocking control in assays to test for specificity of LYPLA2 antibody, catalog no. 70R-3616

GEMIN4 antibody was raised in Rabbit using Human GEMIN4 as the immunogen

CD5 antibody (PE) was raised in rat using CD5/Lyt-1 as the immunogen.

A synthetic peptide for use as a blocking control in assays to test for specificity of CPN2 antibody, catalog no. 70R-3276

Please enquire for more information about KYT-36 including the price, delivery time and more detailed product information at the technical inquiry form on this page

The DDX4 antibody is a monoclonal antibody that specifically targets the DDX4 cell antigen. This antibody plays a crucial role in various cellular processes, including exocytosis and phosphatase activity. It has been shown to modulate the production of interleukin-6 (IL-6), a key cytokine involved in immune responses. The DDX4 antibody also exhibits high specificity towards antigens such as hemagglutinin, transferrin, and glycosylation markers. In Life Sciences research, this antibody is widely used for nuclear staining and detection of DDX4 expression. Its unique binding properties make it an invaluable tool for studying cellular processes and protein interactions. With its exceptional performance and reliability, the DDX4 antibody is the go-to choice for researchers in the field of immunology and molecular biology.

A synthetic peptide for use as a blocking control in assays to test for specificity of TLR5 antibody, catalog no. 70R-5979

GDC-0077 is a small molecule that specifically targets the lipid kinase activity of CDK4/6. It has been shown to have anti-inflammatory effects in animal models of inflammatory diseases, such as arthritis and colitis, by suppressing the expression of inflammatory genes. GDC-0077 has also been shown to be effective in suppressing tumor growth and prolonging survival in animal models of cancer. GDC-0077 inhibits the proliferation of cancer cells by interrupting cell cycle progression at the G2/M checkpoint. The compound is being investigated for its potential as a treatment for cancers with mutations in CDK4 or CDK6, such as breast, prostate, and endometrial cancers.

GIT2 antibody was raised in rabbit using the C terminal of GIT2 as the immunogen

CMVpp65 - 64 is a custom research peptide; min purity 95%, TFA salt. For different specs please use the Peptide Quote Tool

Peptide Beta-Amyloid (17-28) is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

A synthetic peptide for use as a blocking control in assays to test for specificity of SNF1LK antibody, catalog no. 70R-1185

Peptide H-YKQTSV-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Affinity purified Rabbit polyclonal CLN2 antibody

Rabbit polyclonal RRAGA antibody (biotin)

MC 976 is an analog of vitamin D3 that has been chemically modified to inhibit the production of hepatocyte proteins. MC 976 is a cyclopropane derivative and its epimeric carbon is substituted with a tritiated atom. This analog has been shown to be effective in inhibiting the synthesis of human liver proteins in cell culture models. The activity of MC 976 can be reversed by exposure to ultraviolet light or by treatment with an epimerase.

A synthetic peptide for use as a blocking control in assays to test for specificity of OSBPL8 antibody, catalog no. 70R-6726

H-CSRNLIDCGGGDGGCSRNLIDC-OH is a custom research peptide; min purity 95%, TFA salt. For different specs please use the Peptide Quote Tool

A synthetic peptide for use as a blocking control in assays to test for specificity of STK38L antibody, catalog no. 70R-4530

A synthetic peptide for use as a blocking control in assays to test for specificity of MVP antibody, catalog no. 70R-2052

A synthetic peptide for use as a blocking control in assays to test for specificity of LTB antibody, catalog no. 70R-6690

Peptide H-VVGGE-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Rabbit polyclonal Osteopontin antibody (HRP)

Mouse monoclonal GSTT2 antibody

MUC1(126-149)-Tn (140) is a custom research peptide; min purity 95%, TFA salt. For different specs please use the Peptide Quote Tool

A synthetic peptide for use as a blocking control in assays to test for specificity of Ano6 antibody, catalog no. 70R-8606

The ATM antibody is a highly specialized monoclonal antibody that has been designed to target and bind to the ATM protein. This protein plays a crucial role in the DNA damage response pathway and is involved in cell cycle regulation, DNA repair, and apoptosis. The ATM antibody can be used in various research applications, including molecular docking studies, immunoassays, and hybridization experiments. It has been shown to specifically recognize and form a complex with the epidermal growth factor (EGF)-like domain of the ATM protein. Additionally, the ATM antibody exhibits high affinity for albumin, a major component of human serum. Its unique binding properties make it an invaluable tool for scientists working in the field of life sciences who are studying cellular processes related to DNA damage and repair.

Peptide H-LSEPAEITDAVK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Rat monoclonal CD24 antibody (FITC)

Peptide H-YLDEIPPKF-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

A synthetic peptide for use as a blocking control in assays to test for specificity of Lgi2 antibody, catalog no. 70R-8683

Affinity purified Chicken polyclonal 200 kDa Neurofilament antibody

Peptide H-RRRRRRRRRC-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Peptide H-PVLDLFRELLNELLEALKQKLK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

A synthetic peptide for use as a blocking control in assays to test for specificity of PLP2 antibody, catalog no. 70R-1891

A synthetic peptide for use as a blocking control in assays to test for specificity of UST antibody, catalog no. 70R-6963

PSMB6 antibody was raised using a synthetic peptide corresponding to a region with amino acids TTIMAVQFDGGVVLGADSRTTTGSYIANRVTDKLTPIHDRIFCCRSGSAA

Thymosin, beta 10 (human, rat) is a custom research peptide; min purity 95%, TFA salt. For different specs please use the Peptide Quote Tool

A synthetic peptide for use as a blocking control in assays to test for specificity of SEPT11 antibody, catalog no. 70R-5568

Peptide Melanoma-overexpressed antigen 1 (36-44) is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

CD28 antibody (PE) was raised in mouse using chicken CD28 as the immunogen.

Peptide PEP1 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Mouse monoclonal EMA antibody (biotin conjugated)

Ssm 3 trifluoroacetate (S3-TF) is a research tool that is used to activate ligands and receptors. It also binds to ion channels, which are proteins that transport ions across the cell membrane, regulating the flow of ions into and out of cells. Furthermore, S3-TF is used in pharmacology and as an inhibitor in cell biology. S3-TF is also known as a high purity reagent that has been shown to be useful for protein interactions, antibody production and peptide synthesis.

Peptide H-SIRLPGCPRGVNPVV-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Affinity purified Rabbit polyclonal DNAJB2 antibody

PDLIM1 antibody was raised in rabbit using the middle region of PDLIM1 as the immunogen

Peptide H-LPFFSNVTWF-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Peptide H-SFNR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Peptide H-VLIQFLQK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Peptide Ac-ASGVAVSDGVIK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

A synthetic peptide for use as a blocking control in assays to test for specificity of MMP1 antibody, catalog no. 70R-1556

H-GRCRGFRRRCFCTTHC-OH is a custom research peptide; min purity 95%, TFA salt. For different specs please use the Peptide Quote Tool

CMVpp65 - 93 is a custom research peptide; min purity 95%, TFA salt. For different specs please use the Peptide Quote Tool

A synthetic peptide for use as a blocking control in assays to test for specificity of DPYS antibody, catalog no. 70R-1173

A synthetic peptide for use as a blocking control in assays to test for specificity of PVRL3 antibody, catalog no. 70R-6425

CMVpp65 - 9 is a custom research peptide; min purity 95%, TFA salt. For different specs please use the Peptide Quote Tool

A synthetic peptide for use as a blocking control in assays to test for specificity of PITPNM1 antibody, catalog no. 70R-9888

Rat monoclonal CD5 antibody (allophycocyanin)

Peptide H-SQNPVQPIGPQTPK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Purified Rabbit polyclonal NDUFA4 antibody

Peptide H-VMTPRTLVL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Rabbit polyclonal SSSCA1 antibody

Peptide H-AEDTAVYYCAR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

A synthetic peptide for use as a blocking control in assays to test for specificity of RP11-35F15.2 antibody, catalog no. 70R-6714

Peptide Dermaseptin is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Peptide H-ILVDWLVEV-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

A synthetic peptide for use as a blocking control in assays to test for specificity of RBBP7 antibody, catalog no. 70R-2124

SynB1 is a custom research peptide; min purity 95%, TFA salt. For different specs please use the Peptide Quote Tool

The beta Amyloid antibody is a powerful tool in the field of Life Sciences. It is a polyclonal antibody that specifically targets the amyloid protein, which is associated with various neurodegenerative disorders such as Alzheimer's disease. This antibody has been extensively tested and validated for use in immunoassays, making it an essential component in research and diagnostic applications.

The STEAP1 antibody is a highly specialized antibody that targets the phosphatase STEAP1. This antibody has cytotoxic properties and has been shown to disrupt actin filaments, leading to cell death. It is available as both polyclonal and monoclonal antibodies, offering researchers a range of options for their experiments. In the field of Life Sciences, this antibody is widely used for its neutralizing effects on STEAP1 activity. The monoclonal antibody variant has been specifically designed to be activated upon binding to STEAP1, ensuring optimal performance in immunoassays. With its high affinity and specificity, this antibody can be used in various applications such as Western blotting, immunofluorescence, and flow cytometry. Researchers can rely on the STEAP1 antibody to accurately detect and measure the levels of this important glycoprotein in their experiments.

Affinity purified Rabbit polyclonal ARHGAP4 antibody

Peptide H-EKL-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

CMVpp65 - 32 is a custom research peptide; min purity 95%, TFA salt. For different specs please use the Peptide Quote Tool

Affinity purified Rabbit polyclonal MGAT3 antibody

A synthetic peptide for use as a blocking control in assays to test for specificity of IL10RA antibody, catalog no. 70R-1865

Affinity purified Rabbit polyclonal IL1 Receptor 2 antibody

A synthetic peptide for use as a blocking control in assays to test for specificity of ABCG5 antibody, catalog no. 70R-6712

Purified recombinant NFkB p105 subunit protein

Rabbit polyclonal OLIG1 antibody

A synthetic peptide for use as a blocking control in assays to test for specificity of FER1L3 antibody, catalog no. 70R-6290

Peptide H-IKNNLKDCGLF-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

A synthetic peptide for use as a blocking control in assays to test for specificity of GCDH antibody, catalog no. 70R-2402

Leptin (57 - 74) is a custom research peptide; min purity 95%, TFA salt. For different specs please use the Peptide Quote Tool

KLK1 antibody was raised in Rabbit using Human KLK1 as the immunogen

Peptide H-IGLDLPALNMQR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

The APE1 antibody is a highly specific monoclonal antibody that targets endoplasmic reticulum aminopeptidase 1 (APE1). It is used in Life Sciences research to study the role of APE1 in various cellular processes. This antibody has been shown to neutralize the activity of APE1, which is involved in DNA repair and redox regulation. It can be used for immunoprecipitation, Western blotting, and immunofluorescence experiments. The APE1 antibody has been validated using mass spectrometric methods and has been shown to specifically recognize APE1 in nuclear extracts. It can also be immobilized on an electrode for use in electrochemical assays. With its high specificity and versatility, the APE1 antibody is an essential tool for researchers studying growth factors, signal transduction pathways, and DNA repair mechanisms.

Peptide H-GCGGGYGRKKRRQRRR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Cliotide T4 is a custom research peptide; min purity 95%, TFA salt. For different specs please use the Peptide Quote Tool

Peptide H-GGH-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Affinity purified Rabbit polyclonal ETEA antibody

Peptide H-TSTTVDLK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Lp (a) antibody was raised in rabbit using the middle region of LPA as the immunogen

Peptide H-ILVDWLVQV-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

H-ANALLANG-OH is a custom research peptide; min purity 95%, TFA salt. For different specs please use the Peptide Quote Tool

CD38 antibody (PE) was raised in rat using CD38 as the immunogen.

CD3e antibody (PE) was raised in hamster using H-2Kb-specific mouse cytotoxic T lymphocyte as the immunogen.

CFM 4 is a uv-absorbing analog of the fatty acid, γ-linolenic acid. It has been shown to inhibit tumor growth in mice with metastatic properties, and may be useful for the treatment of certain types of cancer. CFM 4 inhibits β-catenin signaling in cells by inhibiting fatty acid synthesis. It also shows biological properties that have been attributed to its ability to inhibit cell cycle progression. CFM 4 inhibits the growth of breast cancer cells by inducing apoptosis and has been shown to be effective against other types of cancer as well.
CFM 4 is used in tissue culture experiments as a source of energy for chloroplasts and can be cycled back into chloroplasts after it has been removed from the cell.

SLC35F5 antibody was raised using the C terminal of SLC35F5 corresponding to a region with amino acids VDREDKLDIPMFFGFVGLFNLLLLWPGFFLLHYTGFEDFEFPNKVVLMCI

A synthetic peptide for use as a blocking control in assays to test for specificity of CLGN antibody, catalog no. 70R-1894

CD152 antibody (biotin) was raised in hamster using murine CD152/CTLA-4 as the immunogen.

A synthetic peptide for use as a blocking control in assays to test for specificity of TCF25 antibody, catalog no. 20R-1266

Chlamydia trachomatis antibody (HRP) was raised in rabbit using L2 and other serovar groups as the immunogen.

DDIT4L antibody was raised in Rabbit using Human DDIT4L as the immunogen

CD154 antibody (FITC) was raised in hamster using activated murine Th1 clone D1.6 as the immunogen.

A synthetic peptide for use as a blocking control in assays to test for specificity of PHYHIPL antibody, catalog no. 70R-9911

A synthetic peptide for use as a blocking control in assays to test for specificity of CLDN18 antibody, catalog no. 70R-6932

PB 28 dihydrochloride is a selective sigma-2 receptor ligand, which is a synthetic compound targeting specific receptor sites. These receptors are predominantly found in cancer cells, implicating them in cellular proliferation and apoptosis. PB 28 dihydrochloride is synthetically derived and is employed extensively in preclinical studies. Its mode of action involves high-affinity binding to the sigma-2 receptors, allowing modulation of cellular stress responses and apoptosis pathways.

A synthetic peptide for use as a blocking control in assays to test for specificity of FLJ14803 antibody, catalog no. 70R-6988

The RAGE antibody is a monoclonal antibody that specifically targets the receptor for advanced glycation end products (RAGE). It is derived from human serum albumin and has been shown to have neutralizing properties against various growth factors, chemokines, and epidermal growth factor-like molecules. The RAGE antibody works by inhibiting the binding of these molecules to RAGE, thereby preventing their downstream signaling pathways. This antibody can be used in various life science research applications, such as immunohistochemistry, Western blotting, and flow cytometry. Additionally, polyclonal antibodies are also available for those who require a broader range of target recognition. With its high specificity and inhibitory effects, the RAGE antibody is a valuable tool for studying the role of RAGE in various biological processes.

A synthetic peptide for use as a blocking control in assays to test for specificity of PTGER3 antibody, catalog no. 70R-6481

PPP1R12A antibody was raised in rabbit using the C terminal of PPP1R12A as the immunogen

CD30 antibody (biotin) was raised in hamster using recombinant murine CD30 extracellular domain-mouse IgG1 fusion protein as the immunogen.

A synthetic peptide for use as a blocking control in assays to test for specificity of LARP4 antibody, catalog no. 70R-4972

A synthetic peptide for use as a blocking control in assays to test for specificity of CPEB2 antibody, catalog no. 70R-4879

Affinity purified Rabbit polyclonal DUSP7 antibody

Peroxiredoxin-2 is a protein that belongs to the peroxidase family of enzymes. It has been shown to be an activator of ion channels, which suggests that it may play a role in cell regulation. Peroxiredoxin-2 has also been shown to bind to peptides and antibodies, with potential therapeutic applications.

A synthetic peptide for use as a blocking control in assays to test for specificity of RFC3 antibody, catalog no. 70R-5527

CD25 antibody (FITC) was raised in rat using alpha chain IL-2 receptor as the immunogen.

Rabbit polyclonal SYT17 antibody

A synthetic peptide for use as a blocking control in assays to test for specificity of SKAP1 antibody, catalog no. 70R-5761

A synthetic peptide for use as a blocking control in assays to test for specificity of FBXO25 antibody, catalog no. 70R-2788

A synthetic peptide for use as a blocking control in assays to test for specificity of SNIP1 antibody, catalog no. 70R-7996

The STOML1 antibody is a highly specialized monoclonal antibody that targets the hepatocyte growth factor (HGF) receptor. It specifically binds to the histidine residues on the receptor, blocking its activation and inhibiting downstream signaling pathways. This antibody has been extensively studied in Life Sciences research and has shown promising results in various applications.

2-[(4-Oxo-3-phenyl-5H-pyrimido[5,4-b]indol-2-yl)sulfanyl]-N-phenylacetamide is a synthetic small molecule that was originally designed to be an inhibitor of the α1A subtype of the voltage gated L type calcium channel. It has also been shown to be an activator of the TASK1 potassium channel and have potential as a drug for the treatment of conditions such as stroke. This compound is not currently available commercially but can be synthesized on request.

Affinity purified Rabbit polyclonal LOC169436 antibody

CD69 antibody (biotin) was raised in hamster using Y245 murine dendritic epidermal T cell line as the immunogen.

A synthetic peptide for use as a blocking control in assays to test for specificity of NME4 antibody, catalog no. 70R-3129

A synthetic peptide for use as a blocking control in assays to test for specificity of PRR16 antibody, catalog no. 70R-3413

C16orf70 antibody was raised in Rabbit using Human C16orf70 as the immunogen

Affinity purified Rabbit polyclonal EIF2B beta antibody

A synthetic peptide for use as a blocking control in assays to test for specificity of SMNDC1 antibody, catalog no. 70R-5033

CD45R antibody (Allophycocyanin) was raised in rat using abelson murine leukemia virus-induced pre-B tumor cells as the immunogen.

KAT5 antibody was raised in Rabbit using Human KAT5 as the immunogen

The Hemoglobin antibody is a powerful tool used in various research and diagnostic applications. It specifically targets the virus surface antigen and amyloid plaque, making it an essential component in studying viral infections and neurodegenerative diseases.

A synthetic peptide for use as a blocking control in assays to test for specificity of NSUN5C antibody, catalog no. 70R-1208

A synthetic peptide for use as a blocking control in assays to test for specificity of TGOLN2 antibody, catalog no. 70R-7394

CD24 antibody (biotin) was raised in rat using murine heat stable antigen as the immunogen.

Mouse anti-Human Monoclonal CD16 antibody

CD117 antibody (CY5) was raised in rat using murine CD117/c-Kit as the immunogen.

A synthetic peptide for use as a blocking control in assays to test for specificity of TMEM176A antibody, catalog no. 70R-6936

The HSP90 rabbit polyclonal antibody is a research tool that can be used to study the activation of HSP90. This antibody is raised against peptides from the human Hsp90 and has been shown to inhibit the activity of HSP90. The high purity level ensures that this antibody will not cause any background noise during experiments. This product is for use in life science and cell biology applications, as well as for pharmacology and receptor studies.

Rabbit polyclonal INHBB antibody

HRC antibody was raised in Rabbit using Human HRC as the immunogen

HS3ST6 antibody was raised using a synthetic peptide corresponding to a region with amino acids GERLVSDPAGEVGRVQDFLGLKRVVTDKHFYFNATKGFPCLKKAQGGSRP

MAPK14 antibody was raised in rabbit using the C terminal of MAPK14 as the immunogen

A synthetic peptide for use as a blocking control in assays to test for specificity of MIF4GD antibody, catalog no. 70R-1452