Biochemicals and Reagents

<p>BRD6688 is a protein inhibitor that binds to and inhibits the activity of GABA transporters. It is a potent inhibitor of the gaba transporter (GAT) with an IC50 of 0.2 μM. BRD6688 has been shown to inhibit the acetylation of histone proteins, which are important for transcriptional regulation and gene expression. BRD6688 also has a thermodynamic inhibitory constant (Ki) of 1.4 μM and a kinetic inhibitory constant (Ki) of 0.3 μM, indicating that it binds tightly to GATs and does not dissociate easily from it. The Ki values were determined by measuring the inhibition of GAT-mediated chloride transport in cells cultured in vitro. This drug also inhibits antigen presentation in T cells by inhibiting protein synthesis and cell division, as well as histone methylation during mitosis, leading to downregulation of cell-surface antigens on B cells.</p>

<p>Please enquire for more information about YM-53601 including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Antifreeze Polypeptide 6 (AFP6) is a protein that belongs to the family of antifreeze proteins. AFP6 binds to ion channels and prevents the flow of ions, which prevents the formation of ice crystals. It also has been shown to interact with other proteins, such as receptors and peptides. This protein has been shown to be a research tool for studying cell biology and pharmacology. The CAS number for AFP6 is 122604-16-4.</p>

<p>Please enquire for more information about 5,6-Dehydro finasteride including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Iodopolystyrene resin ,100-200 mesh including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>TNO155 is an innovative therapeutic agent, commonly classified as a small-molecule inhibitor, which is derived from rational drug design based on precision oncology principles. Its mode of action involves selective inhibition of a specific protein tyrosine phosphatase, which plays a critical role in cellular signaling pathways that are often dysregulated in cancer. This inhibition effectively disrupts aberrant signaling, thereby suppressing tumor cell proliferation and inducing apoptosis in malignant cells.</p>

<p>Trifluoroacetate salt</p>

<p>H-KCDICTDEY-OH peptide, corresponding to amino acids 243-251 of human Tyrosinase. The peptide is supplied as an acetate salt.</p>

<p>H-ADAQHATPPKKKRKVEDPKDF-OH peptide, which can act as a substrate of Protein Kinase P34 (cd2). The peptide is supplied as a trifluoroacetate salt.</p>

<p>H-AFLPWHRLF-OH peptide, corresponding to amino acids 206-214 of human Tyrosinase. The peptide is supplied as an acetate salt.</p>

<p>H-SEIWRDIDF-OH peptide, corresponding to amino acids 192-200 of human and mouse Tyrosinase. The peptide is supplied as an acetate salt.</p>

<p>H-AKKLSKDRMKKYMARRKWQKTG-NH2 peptide, corresponding to 480-501 amnino acids of Myosin Light Chain Kinase. Myosin Light Chain Kinase is a serine/threonine specific protein kinase that phosphorylates the myosin light chain.</p>

<p>H-SYLQDSVPDSFQD-OH peptide, corresponding to amino acids 432-444 of human Tyrosinase. The peptide is supplied as an acetate salt.</p>

<p>AZD 5991 is a cell-specific compound that inhibits the apoptosis pathway. It has been shown to have potent antitumor activity against T-cell lymphomas and other cancers in vitro and in vivo. AZD 5991 targets cyclin D2 and PCSK9, which are proteins involved in the regulation of the cell cycle, thereby inhibiting tumor growth. This drug also exhibits potent inhibition of ribosome synthesis, which may be due to its ability to inhibit protein synthesis by targeting the enzyme activities required for ribosome production. AZD 5991 also exhibits anti-inflammatory properties that may be due to its ability to inhibit colony-stimulating factor (CSF) production.</p>

<p>Please enquire for more information about Fmoc-D-Ser(BSi)-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>H-9 hydrochloride is a selective protein kinase inhibitor, which is synthetically derived. It primarily inhibits cyclic nucleotide-dependent protein kinases, including protein kinase A (PKA) and protein kinase G (PKG), along with myosin light chain kinase (MLCK). The mode of action involves competitive inhibition at the ATP binding site of these kinases, thereby impacting phosphorylation pathways crucial for multiple physiological functions. The selective inhibition by H-9 hydrochloride allows for detailed exploration of kinase-mediated signaling pathways in cellular biology. Moreover, it is extensively utilized in studies involving cell motility, smooth muscle contraction, and signal transduction. The relevance of H-9 hydrochloride in academic research lies in its ability to provide insights into kinase activity modulation and its ensuing effects on cellular dynamics. This compound serves as an invaluable tool for scientists aiming to elucidate the complex role of protein kinases in health and disease, enabling the development of innovative therapeutic strategies.</p>

<p>H-Ile-Trp-OH is an acetylcholine esterase inhibitor that has been shown to have potent inhibitory activity against lorazepam. It binds to the active site of the enzyme, preventing it from breaking down acetylcholine and other neurotransmitters in the brain. H-Ile-Trp-OH is also a potent inhibitor of stenotrophomonas maltophilia, which is a bacterium found in chronic bronchitis patients. The drug has been tested in clinical studies for use as an immunomodulatory agent but has not yet been approved for this purpose.</p>

<p>Please enquire for more information about Boc-Thr(Ala-Fmoc)-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Contains 0.1% Proclin300 as preservative</p>

<p>JNJ 10397049 is a pharmacological compound categorized as a selective T-type calcium channel blocker, which is a synthetic compound designed for specific targeting of calcium channels. The product functions by inhibiting T-type calcium channels, which are voltage-gated ion channels involved in the regulation of intracellular calcium levels. This inhibition leads to a decrease in calcium influx, modulating neuronal excitability and reducing excessive neuronal firing.</p>

<p>Cyclosporine U is a cyclic polypeptide immunosuppressant, which is a derivative of the natural product Cyclosporine A, produced by the fermentation process involving the filamentous fungus *Tolypocladium inflatum*. It primarily acts by inhibiting the activity of calcineurin, a phosphatase enzyme, which in turn blocks the transcription of interleukin-2 and other cytokines. This mechanism suppresses the activation of T-lymphocytes, a crucial component in the immune response.</p>

<p>Beta-Endorphin (30-31) is a protein that binds to the carotid. It has been shown to promote the growth of bacteria in culture, and is thought to be involved in the regulation of bacterial DNA replication. Beta-Endorphin (30-31) has a molecular weight of approximately 3,000 Daltons and contains two hydroxyl groups. This protein may also be involved in protein synthesis and hydrogen bonding with other proteins.</p>

<p>Primordazine B is a small molecule that belongs to the class of Ion Channels. It has been shown to inhibit the activation of Ligand-Gated Ion Channels, such as nicotinic acetylcholine receptors. Primordazine B has also been shown to activate Receptor Tyrosine Kinases and inhibit Protein Phosphatase 2A (PP2A). This drug is used as a research tool in pharmacology and cell biology, as well as an antibody production reagent. Primordazine B is a high purity compound with a CAS number of 339337-07-4.</p>

<p>Please enquire for more information about Z-D-Arg(Z)2-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Azelaprag is a prodrug of saquinavir that has been shown to be effective in the prevention and treatment of pyloric stenosis. It is administered orally and can be detected in the blood, nasal secretions, or urine. Azelaprag is also active against Staphylococcus and Streptococcus isolates, but not against other bacteria. Azelaprag has been shown to produce drug reactions in women and infants, with detectable levels in the blood or urine.</p>

<p>Kisspeptin P</p>

<p>Cyclopyrimorate is a small molecule that has been shown to inhibit the activity of protein kinase C (PKC). Cyclopyrimorate is a potent activator of PKC, and it has been shown to interact with both the ligand binding domain and the activation domain. This inhibitor binds to the ATP binding site on PKC, blocking access by ATP and inhibiting phosphorylation. Cyclopyrimorate has also been shown to have effects on ion channels, including voltage-gated potassium channels, calcium activated potassium channels, and nicotinic acetylcholine receptors. Cyclopyrimorate is a research tool for studying protein interactions in cells. It can be used as an antibody against PKC for immunocytochemistry or Western blotting experiments.</p>

<p>Berubicin is an anthracycline-based chemotherapeutic agent, which is a semi-synthetic derivative sourced primarily from the bacterium Streptomyces peucetius. It operates by intercalating into DNA strands, disrupting the replication and transcription processes, which ultimately induces apoptosis in rapidly dividing tumor cells.</p>

<p>Inhibitor of Janus kinase JAK-1</p>

<p>Sheep polyclonal Creatinine Acid antibody</p>

<p>Z-Ala-Ala-Asn-AMC is a molecule that is an analog of the amino acid alanine. It has been shown to be effective in inhibiting cancer cell viability and inducing apoptosis in MDA-MB-231 breast cancer cells, which can inhibit tumor growth. This molecule also inhibits protease activity, protein synthesis, and tubule cell proliferation. Z-Ala-Ala-Asn-AMC has applicability in the treatment of cancers and inflammatory diseases.</p>

<p>Z-Ile-Glu(OtBu)-Ala-Leu-aldehyde, also known as ZILEAL, is a potent immunosuppressant that binds to the Toll-like receptor (TLR) and inhibits NF-κB binding activity. It has been shown to reduce the activation of macrophages by inhibiting the production of proinflammatory cytokines such as tumor necrosis factor alpha (TNFα), IL-1β, and IL-6. This drug has been shown to inhibit HIV replication in vitro and was also found to have an antiviral effect against herpes simplex virus type 1 in vivo. ZILEAL also inhibits dsDNA binding activity, which may have potential applications in cancer treatment.</p>

<p>Fmoc-Leu-Gly-OH is a dipeptide that is reversibly soluble in water and organic solvents. It has been found to be stable at millimeter and nanometer scales, which makes it suitable for use as a hydrogel or fiber. Fmoc-Leu-Gly-OH has also been shown to form membranes of variable thickness (from micrometers to nanometers) that are sensitive to pH changes. This means that the membrane can be used for sensing pH levels in a variety of environments. Dipeptides are amphiphiles, meaning they have both hydrophilic and lipophilic properties. This makes them useful for forming self-assembled structures, such as hydrogels and membranes, that are capable of transporting water molecules through the structure.</p>

<p>Z-Gly-Val-OH is an inhibitor that can be used for the synthesis of peptides. It is a c-terminal amino acid with an optically active, cyclic structure. Z-Gly-Val-OH can be coupled to azide and spheric amino acids, and it undergoes racemization in solvents containing additives. This reagent can also be used for the synthesis of peptides with epimerization or chlorine.</p>

<p>First generation PI 3-kinase inhibitor</p>

<p>Monoclonal antibody against RANKL; anti-resorptive agent for osteoperosis treatment</p>

<p>Please enquire for more information about H-Ile-Ile-Ile-OH acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Fmoc-Lys(Nde)-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about 8S-Cabergoline including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Omega-Conotoxin MVIIC is a peptide toxin that blocks the voltage-dependent calcium channels. It has been shown to have neuroprotective properties and to inhibit glutamate induced neurotoxicity in vitro and in vivo. Omega-Conotoxin MVIIC inhibits neurotransmitter release by blocking the calcium channels and thereby reduces oxidative stress, which prevents neuronal cell death. This toxin also blocks the activity of voltage-dependent sodium channels, but its effects are not as potent as those on calcium channels. Omega-Conotoxin MVIIC has been found to be effective against cerebellar granule neurons, as well as other neurons in the brainstem, cerebellum, hippocampus, and cerebral cortex. The molecular weight of this toxin is approximately 10 kDa and it contains subunits (a total of eight).</p>

<p>Please enquire for more information about Fmoc-Gly-Cys(Psi(Dmp,H)pro)-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Human ACTH(18-39) trifluoroacetate including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about H-D-Ala-Gln-octadecyl ester·HCl including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>H-DL-Ala-DL-Ala-OH is a chemical that belongs to the group of amides. It has been shown to have an inhibitory effect on the growth of bacteria in vitro. The molecular weight and stability of H-DL-Ala-DL-Ala-OH are greater than those of vancomycin, which may be due to its higher nitrogen content. This chemical can be used as a model system for studying the reaction mechanism and structure of vancomycin, including the formation of intramolecular hydrogen bonds and carbonyl oxygens. H-DL-Ala-DL-Ala-OH also has antibiotic properties that are similar to penicillin.</p>

<p>Protease-activated receptor 1 (PAR-1) selective activating peptide, TFA salt. 98%.</p>

<p>Panaxynol is an active compound that belongs to the group of polyphenols. It has been shown to inhibit nuclear DNA synthesis in human leukemic HL-60 cells. This inhibition is due to its ability to bind with the dextran sulfate moiety of DNA, thereby preventing DNA synthesis. Panaxynol also has antibacterial efficacy against gram-positive bacteria and significant cytotoxic effects on HL-60 cells.</p>

<p>Angiotensin II is a peptide hormone that is also known as angiotensin II trifluoroacetate salt. It has been shown to have cardioprotective effects in vivo and in vitro models. Angiotensin II has been shown to induce follicular growth, inhibit atherosclerotic lesion formation, and improve cardiac function. Angiotensin II can be used to treat patients with congestive heart failure or cardiovascular disease due to its ability to increase blood pressure and the rate of cardiac contractions. The drug also reduces systolic pressure by acting on receptors in the kidneys and vasculature, which are involved in the renin-angiotensin system.</p>

<p>Component of snake venom; part of a family of vasoconstrictor isopeptides</p>

<p>H-Pro-Thr-Glu-Phe-p-nitro-Phe-Arg-Leu-OH is a proteolytic inhibitor that inhibits the aspartic and hydrolytic enzymes. It has been shown to inhibit the activity of trypsin, pepsin, and elastase in human serum. This inhibitor also inactivates fibronectin by proteolysis. H-Pro-Thr-Glu-Phe-p-nitro-Phe-Arg-Leu OH has been shown to be specific for acidic proteases such as pepsin. The natural inhibitors of this peptide are Pro, Thr, Glu, Phe, Arg and Leu.</p>

<p>ARV-471 is an anticancer drug that acts as a Chinese hamster ovary (CHO) cell inhibitor. It is a potent and selective kinase inhibitor that has been shown to induce apoptosis in cancer cells. ARV-471 is a protein analog of nifedipine, which is a calcium channel blocker used to treat high blood pressure and angina. This drug works by inhibiting kinases, which are enzymes that regulate cellular growth and proliferation. ARV-471 has been demonstrated to be effective in treating various types of cancer, including breast cancer, by inhibiting the growth of tumor cells and inducing apoptosis. Its unique mechanism of action makes it a promising candidate for future cancer therapies.</p>

<p>Growth hormone-releasing factor (GRF) or GHRH (growth hormone-releasing hormone).Binds to the growth hormone-releasing hormone receptor (GHRH-R), causing growth hormone secretion.porcine: H-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGERNQEQGARVRL-NH2bovine:  H-YADAIFTNSYRKVLGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2ovine:    H-YADAIFTNSYRKILGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2human:  H-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL-NH2</p>

<p>Boc-Lys(Tfa)-AMC is a small molecule that inhibits the acetylation of histone H3 and has anticancer activity. Acetylation increases the rate of transcription and replication, whereas Boc-Lys(Tfa)-AMC inhibits this process by preventing acetylation. This drug also binds to δ-opioid receptors in cancer cells, triggering a redox signal that leads to inhibition of cancer cell proliferation. The mechanism of this drug's anticancer activity is unknown, but it may be due to its ability to inhibit enzyme activities or disulfide bond formation in vivo.</p>

<p>Policosanol is a natural substance that is obtained from sugar cane. It is a mixture of various alcohols, including octacosanol, hexacosanol, heptacosanol, and octacosanol. Policosanol has been studied for its potential to treat high cholesterol levels in the blood by reducing low-density lipoprotein-cholesterol (LDL-C) and triglycerides. Animal studies have shown that policosanol can lower LDL-C and reduce the risk of heart disease by preventing the formation of plaque in the arteries. Policosanol also reduces the risk of heart attack and stroke by lowering blood pressure and decreasing platelet aggregation. It may also be used as an antioxidant or anti-inflammatory agent.</p>

<p>Please enquire for more information about (Gly22)-Amyloid b-Protein (1-42) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Enantio-PAF C-16, or 3-O-Hexadecyl-2-O-acetyl-sn-glycero-1-phosphocholine,  is a biologically inactive enatiomer of platelet-activating factor (PAF). It is a PAF receptor agonist.</p>

<p>Phosphate reservoir in muscles, aiding conversion of ADP to ATP</p>

<p>Please enquire for more information about Ehrlichia Canis gp19 Antigen, Recombinant including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>H-Glu-Ala-OH is a human protein that belongs to the family of glycosylated proteins. It is expressed in the cells of the ovary and is a member of the insulin-like growth factor (IGF) superfamily. H-Glu-Ala-OH binds to lectins in mammalian cells, which may be due to its sulfoxide group. This protein has been shown to have dehydrogenase activity and polymerase chain reaction (PCR) amplification properties. H-Glu-Ala-OH has also been shown to inhibit growth in cell culture and promote apoptosis, which may be due to its ability to regulate IGF levels in mammalian cells.br&gt;br&gt;<br>br&gt;br&gt;<br>This protein is found at high levels in ovarian cancer cells and serum from patients with ovarian cancer. The sequence of this protein has been determined using mass spectrometry analysis on ovary extracts and on cDNA derived from human embryonic kidney (</p>

<p>Please enquire for more information about Boc-D-His(Boc)-OH benzene solvate including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>BCIP (5-bromo-4-chloro-3-indolyl phosphate) dipotassium is a chromogenic substrate commonly used for the detection of the enzymatic activity of alkaline phosphatase. Upon dephosphorylation by alkaline phosphatase, BCIP produces a blue precipitate, which can be easily visualized. This substrate has various uses, including the detection of gene expression in molecular biology, the identification of alkaline phosphatase activity in clinical pathology, and the detection of protein-protein interactions in biochemistry. Its long-term stability in solution makes it a common choice for many applications.</p>

<p>A component of snake venom, this product contains disulfide bonds between Cys1 and Cys15/Cys3 and Cys11. <br>Due to their structural and functional homology to the endothelin peptides, Sarafotoxins can enhance vasoconstriction through stimulating the class A G-protein-coupled, endothelin ETA and ETB receptors. This in turn leads to left ventricular dysfunction and bronchoconstriction.</p>

<p>H-Ile-His-OH is a peptide that has been found to be an antagonist of the epidermal growth factor receptor. It has been shown to decrease inflammation in animal models of bowel disease and may be useful in the treatment of inflammatory bowel disease. H-Ile-His-OH has also been shown to inhibit the production of inflammatory cytokines such as IL-1β, IL-6, and TNF α. This peptide also inhibits monoclonal antibody production by dendritic cells and can prevent resistant mutants from developing. H-Ile-His-OH is a potent antagonist of Toll-Like Receptor (TLR) 4, TLR2, TLR3, and TLR9. H-Ile-His-OH is currently being investigated for its possible role in the treatment of infectious diseases and autoimmune diseases.</p>

<p>Please enquire for more information about Fmoc-N-Me-D-Arg(Mtr)-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Boc-D-Glu-OEt·DCHA including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>H-Ser-Ile-Lys-Val-Ala-Val-OH is a peptide that is synthesized from the amino acid sequence of the human skin cells. It has been shown to be effective in inhibiting bacterial growth and inducing death in bacteria. This peptide binds to the bacterial cell wall and inhibits its growth. The polymer film can be used for the delivery of H-Ser-Ile-Lys-Val-Ala-Val-OH in the form of lamellar, galacturonic acid, collagen, or lipid nanoparticles. The lamellar phase can be prepared by using water as solvent and lipids as surfactant. The lipid nanoparticle formulation consists of a core material (e.g., cholesterol) surrounded by a lipid bilayer composed of phospholipids or glycolipids with H Ser Ile Lys Val Ala Val OH incorporated into it. This peptide has also been shown to have skin care properties when</p>

<p>Please enquire for more information about N-(2-Amino-ethyl)-2-(benzyl-phenyl-amino)-acetamide including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about N-Acetyl-L-norleucyl-L-a-aspartyl-L-histidyl-3-(2-naphthalenyl)-D-alanyl-L-arginyl-L-tryptophyl-L-lysinamide-(2,7) -lactam including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Z-Ile-Met-OH is a synthetic protease that has been used in the immobilization of κ-carrageenan. The endopeptidase activity of this protease was proved to be higher than that of trypsin and chymotrypsin. It can also be used as an immobilized enzyme for the hydrolysis of polyacrylamide.</p>

<p>CX 5461 is a potent, selective inhibitor of the transcription elongation factor, polymerase (PEP). It binds to the PEP-DNA template complex and blocks dNTP incorporation into RNA. Studies in vitro show that CX 5461 inhibits cancer cell proliferation and induces autophagy and apoptosis. The drug also has genotoxic activity in vitro, as it inhibits DNA synthesis by inhibiting ribosome synthesis. CX 5461 has been shown to be effective against endometriosis in vivo as well as myeloma cells in vitro.</p>

<p>C18:1 Ceramide (d17:1/18:1(9Z)) is a sphingolipid, which is originally sourced from plant or synthetic lipid precursors. Ceramides are integral components of the cellular lipid bilayer and are crucial for maintaining the integrity and function of the skin barrier. Their mode of action involves participating in cell signaling pathways that regulate cellular differentiation, proliferation, and apoptosis.</p>

<p>H-Met-Met-OH is a dietary supplement that has been shown to have a variety of health benefits in animals. It has been shown to increase the production of tnf-α and other fatty acids, which are known to play a role in cellular physiology. H-Met-Met-OH also has the ability to inhibit protein synthesis and this is thought to be due to its transport properties as well as its reaction products. H-Met-Met-OH can be taken orally or given through explants, either orally or by injection.</p>

<p>H-Ile-Arg-OH acetate salt is an antioxidant that belongs to the group of amino acids. It has been shown to have antioxidative activity in vitro, as well as interaction with radicals and free radicals. Cryo-electron microscopy was used to show this compound's radical scavenging activity. H-Ile-Arg-OH acetate salt has also been found to have antioxidative properties in eukaryotes. This compound is composed of two isomers: H-Ile and Arg. The hydroxyl group on the H-Ile isomer gives this compound its antioxidative properties, while the Arg isomer possesses hydrolytic properties. The subunits are linked together by a peptide bond between the carboxyl group on Arg and the amine group on H-Ile. In addition, H-Ile has an -OH hydroxyl group that can be scavenged by hydroxyl radicals, which provides antioxidative activity.</p>

<p>A Good's buffer substance, pKa = 6.15 at 20 degree C.MES, also known as 4-Morpholineethanesulfonic acid, is a morpholinic buffer with an optimal pH range of 5.5-6.7 and a pKa of 6.1. This buffering agent can be used in culture media and capillary electrochromatography. It does not coordinate metal ions</p>

<p>Please enquire for more information about Z-N-Me-D-Ser(tBu)-OH·DCHA including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Glp-1(7-36), amide acetate is a peptide that is used as a research tool in cell biology and pharmacology. It has been shown to activate the GLP-1 receptor, which can lead to inhibition of food intake and glucose production by pancreatic beta cells. Glp-1(7-36), amide acetate binds to the GLP-1 receptor and inhibits the binding of agonists such as exendin-4. This binding blocks the activation of G proteins, leading to an increase in intracellular calcium levels. The high purity of this product makes it ideal for use in research settings where trace impurities may interfere with results.</p>

<p>Please enquire for more information about Boc-Cys(SO3H)-OH·disodium salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Ac-Ala-Leu-Cys-Asp-Asp-Pro-Arg-Val-Asp-Arg-Trp-Tyr-Cys-Gln-Phe-Val-Glu-Gly-NH2 (Disulfide bond) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Selective and potent inhibitor of lysine acetyltransferases KAT6A and KAT6B with IC50 values in low nanomolar range. The compound is a reversible competitor of acetyl coenzyme A domain of KAT6A/B enzymes. It inhibits MYST-catalysed histone acetylation and was shown to arrest lymphoma progression in mice models. The compound opened the door to a new class of cancer therapeutics that could potentially direct the cancer cells in senescence or permanent dormancy.</p>

<p>H-Asp-NH2 is an isomeric mixture of l-phenylalanine and its methyl ester. It is used as a feed additive in animals to improve growth and feed conversion efficiency. The deamination of H-Asp-NH2 produces hydrogen peroxide, which has been shown to be lethal to enterobacteriaceae. This compound may also act as a microbial growth inhibitor by preventing the formation of peptides during synthesis.</p>

<p>MRTX849 is a small molecule inhibitor, which is derived through rational drug design targeting specific oncogenic mutations. It acts as a covalent inhibitor that selectively targets the KRAS G12C mutation, a prevalent alteration in various cancers such as non-small cell lung cancer and colorectal cancer. The mode of action involves binding to the mutated KRAS G12C protein, locking it in an inactive GDP-bound state, thereby inhibiting downstream signaling pathways crucial for tumor cell proliferation and survival.</p>