Biochemicals and Reagents
Subcategories of "Biochemicals and Reagents"
- Biomolecules(98,557 products)
- By Biological Target(101,015 products)
- By Pharmacological Effects(6,941 products)
- Cryopreservatives(21 products)
- Desinfectants and Related Compounds(28 products)
- Hormones(530 products)
- Plant Biology(6,903 products)
- Secondary Metabolites(14,369 products)
Found 130563 products of "Biochemicals and Reagents"
Goat anti Bovine IgG (H + L) (FITC)
Goat anti-Bovine IgG (H + L) (FITC) was raised in goat using purified Bovine IgG (H&L) as the immunogen.
Purity:Min. 95%RAB18 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of RAB18 antibody, catalog no. 70R-5796
Purity:Min. 95%RBMS2 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of RBMS2 antibody, catalog no. 70R-4740
Purity:Min. 95%ZNF474 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of ZNF474 antibody, catalog no. 70R-7871
Purity:Min. 95%TAC1 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of TAC1 antibody, catalog no. 70R-9810
Purity:Min. 95%C2orf25 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of C2orf25 antibody, catalog no. 70R-4055
Purity:Min. 95%ZKSCAN1 antibody
ZKSCAN1 antibody was raised in rabbit using the N terminal of ZKSCAN1 as the immunogen
Purity:Min. 95%GNAO1 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of GNAO1 antibody, catalog no. 70R-5233
Purity:Min. 95%Arpc4 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of Arpc4 antibody, catalog no. 70R-7971
Purity:Min. 95%RAD18 antibody
The RAD18 antibody is a monoclonal antibody used in Life Sciences research. It specifically targets the chemokine receptor RAD18, which is involved in the immune response. This antibody can be used for various applications, such as immunoassays and neutralizing experiments. The RAD18 antibody is a chimeric protein composed of human immunoglobulin and can effectively bind to RAD18 glycoprotein. It has been shown to activate interferon and steroid signaling pathways, making it a valuable tool for studying immune responses and related diseases. With its high specificity and potency, the RAD18 antibody is an essential component in any research involving chemokines and their interactions with the immune system.
TOP2A antibody
The TOP2A antibody is a polyclonal antibody that targets the TOP2A protein. This protein is involved in various cellular processes, including DNA replication and repair. It plays a crucial role in regulating cell growth and division.
PNPLA3 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of PNPLA3 antibody, catalog no. 70R-2371
Purity:Min. 95%RGS13 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of RGS13 antibody, catalog no. 70R-2712
Purity:Min. 95%PSMB9 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of PSMB9 antibody, catalog no. 70R-5740
Purity:Min. 95%Vamp1 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of Vamp1 antibody, catalog no. 70R-9793
Purity:Min. 95%Slc6a9 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of Slc6a9 antibody, catalog no. 70R-8535
Purity:Min. 95%Actin antibody
The Actin antibody is a highly specialized monoclonal antibody that targets actin, a key protein involved in various cellular processes. This antibody has been extensively studied and proven to have neutralizing properties against interferon and fatty acid-induced cytotoxicity. It is widely used in Life Sciences research, particularly in studies related to actin filaments and their role in cell structure and function.
TTF1 antibody
TTF1 antibody was raised in mouse using Rat TTF-1 recombinant protein as the immunogen.
14.3.3 tau protein
1-245 amino acids: MEKTELIQKA KLAEQAERYD DMATCMKAVT EQGAELSNEE RNLLSVAYKN VVGGRRSAWR VISSIEQKTD TSDKKLQLIK DYREKVESEL RSICTTVLEL LDKYLIANAT NPESKVFYLK MKGDYFRYLA EVACGDDRKQ TIDNSQGAYQ EAFDISKKEM QPTHPIRLGL ALNFSVFYYE ILNNPELACT LAKTAFDEAI AELDTLNEDS YKDSTLIMQL LRDNLTLWTS DSAGEECDAA EGAENPurity:Min. 95%IRX3 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of IRX3 antibody, catalog no. 70R-8549
Purity:Min. 95%FCRLA Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of FCRLA antibody, catalog no. 70R-7201
Purity:Min. 95%PDE3B Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of PDE3B antibody, catalog no. 70R-6283
Purity:Min. 95%PAK1 antibody
The PAK1 antibody is a highly specific antibody used in the field of Life Sciences. It is capable of recognizing and binding to the amino-terminal and carboxyl terminal regions of PAK1, a protein involved in various cellular processes. This antibody can be utilized for a wide range of applications, including immunoassays, Western blotting, immunohistochemistry, and more.
XTP3TPA Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of XTP3TPA antibody, catalog no. 70R-1225
Purity:Min. 95%CALML3 antibody
CALML3 antibody was raised in rabbit using the middle region of CALML3 as the immunogen
GALM Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of GALM antibody, catalog no. 70R-3966
Purity:Min. 95%CTSG Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of CTSG antibody, catalog no. 70R-10247
Purity:Min. 95%SMPD3 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of SMPD3 antibody, catalog no. 70R-7194
Purity:Min. 95%ENTHD1 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of ENTHD1 antibody, catalog no. 70R-4166
Purity:Min. 95%Acp2 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of Acp2 antibody, catalog no. 70R-8619
Purity:Min. 95%AKAP10 antibody
AKAP10 antibody was raised using a synthetic peptide corresponding to a region with amino acids ESLYQRTYAGKMTFGRVSDLGQFIRESEPEPDVRKSKGSMFSQAMKKWVQ
PACAP antibody
The PACAP antibody is a proteolytic monoclonal antibody that targets the cyclase-activating peptide (PACAP). It has been shown to exhibit cell cytotoxicity by binding to the conformational epitope of PACAP. This antibody can be used in various applications in the field of Life Sciences, including research on growth factors and as a vaccine adjuvant composition. The PACAP antibody specifically recognizes and binds to PACAP, which is involved in numerous biological processes such as glutamate release and regulation of hormone secretion. Additionally, this antibody has been used in hybridization studies to investigate the expression pattern of PACAP in different tissues. Its ability to modulate cyclase activation makes it a valuable tool for studying signaling pathways mediated by PACAP and its interaction with other molecules such as epidermal growth factor.
DKK1 antibody
DKK1 antibody was raised in Mouse using a purified recombinant fragment of DKK1 expressed in E. coli as the immunogen.ANGPTL4 protein
The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the class of rifamycins. It is highly effective in treating tuberculosis infections, thanks to its bactericidal activity. This active compound inhibits bacterial growth by binding to DNA-dependent RNA polymerase, preventing transcription and replication. Its potency has been demonstrated through extensive research using the patch-clamp technique on human erythrocytes.
Purity:Min. 95%NUP35 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of NUP35 antibody, catalog no. 70R-2173
Purity:Min. 95%SH3RF1 antibody
SH3RF1 antibody was raised using the middle region of SH3RF1 corresponding to a region with amino acids LLKLLSGASTKRKPRVSPPASPTLEVELGSAELPLQGAVGPELPPGGGHG
PCBP3 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of PCBP3 antibody, catalog no. 70R-4780
Purity:Min. 95%KIAA1754L Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of KIAA1754L antibody, catalog no. 70R-6820
Purity:Min. 95%OR13C5 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of OR13C5 antibody, catalog no. 70R-7901
Purity:Min. 95%NUP155 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of NUP155 antibody, catalog no. 70R-2127
Purity:Min. 95%Goat anti Rat IgG (Fab'2) (rhodamine)
Goat anti-rat IgG (Fab'2) (Rhodamine) was raised in goat using rat IgG F(c) fragment as the immunogen.
Purity:Min. 95%GOLGB1 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of GOLGB1 antibody, catalog no. 70R-6855
Purity:Min. 95%ALAD Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of ALAD antibody, catalog no. 70R-3444
Purity:Min. 95%SIRT5 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of SIRT5 antibody, catalog no. 70R-2942
Purity:Min. 95%OR2B2 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of OR2B2 antibody, catalog no. 70R-9857
Purity:Min. 95%Tetraspanin 4 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of TSPAN4 antibody, catalog no. 70R-6337
Purity:Min. 95%CAV2 antibody
The CAV2 antibody is a polyclonal antibody commonly used in the field of life sciences. Polyclonal antibodies are produced by injecting an antigen into an animal, which then produces a wide range of antibodies that can recognize different epitopes on the target protein. This particular polyclonal antibody has been shown to be effective in inhibiting the activity of specific proteins, leading to an antinociceptive effect. Antinociceptives are substances that reduce sensitivity to painful stimuli and can act as analgesic agents. The CAV2 antibody has potential therapeutic applications in the development of analgesic treatments and as part of vaccine strategies against specific strains of pathogens. Its versatility and ability to target multiple epitopes make it a valuable tool for researchers in various fields of study.
MtSSB antibody
The MtSSB antibody is a diagnostic biomarker that plays a crucial role in various biological processes. It is a proline-rich protein that has been extensively studied for its potential applications in medicine. The emission of caveolin-1 and palmitate have been shown to be influenced by the presence of MtSSB antibodies. These antibodies have the ability to inhibit interferon signaling, making them valuable tools for research and diagnostics in the field of Life Sciences. As polyclonal antibodies, they can serve as a reliable detection reagent for identifying and quantifying MtSSB in samples. Additionally, their inhibitory properties make them an attractive target for developing therapeutic strategies against diseases involving reductase activity.
KLK-B1 antibody
KLK-B1 antibody was raised using a synthetic peptide corresponding to a region with amino acids VLTAAHCFDGLPLQDVWRIYSGILNLSDITKDTPFSQIKEIIIHQNYKVS
PHEX antibody
The PHEX antibody is a highly specialized polyclonal antibody that targets the hormone peptide interleukin-6 (IL-6). It is produced using a hybridoma cell line, which ensures high specificity and potency. This antibody acts as an inhibitory factor, neutralizing the effects of IL-6 and preventing its interaction with receptors.
Rab23 antibody
Rab23 antibody was raised in rabbit using the middle region of Rab23 as the immunogen
Purity:Min. 95%PDGF Receptor alpha antibody
PDGF receptor alpha antibody was raised in rabbit using peptide corresponding to amino acids 1035-1053 (C-GKRNRHSSQTSEESAIETG) of human PDGF Receptor slpha as the immunogen.Purity:Min. 95%ADSL Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of ADSL antibody, catalog no. 70R-9952
Purity:Min. 95%LBX2 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of LBX2 antibody, catalog no. 70R-8694
Purity:Min. 95%C2ORF25 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of C2orf25 antibody, catalog no. 70R-2461
Purity:Min. 95%UPB1 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of UPB1 antibody, catalog no. 70R-2279
Purity:Min. 95%CXADR Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of CXADR antibody, catalog no. 70R-6982
Purity:Min. 95%MCM4 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of MCM4 antibody, catalog no. 70R-1599
Purity:Min. 95%ITCH Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of ITCH antibody, catalog no. 70R-2367
Purity:Min. 95%RNF168 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of RNF168 antibody, catalog no. 70R-2817
Purity:Min. 95%CCL2 antibody
The CCL2 antibody is a monoclonal antibody that targets the chemokine CCL2, also known as monocyte chemoattractant protein-1 (MCP-1). It is used in Life Sciences research to study the role of CCL2 in various physiological and pathological processes. This antibody specifically binds to CCL2 and can be used for applications such as immunohistochemistry, flow cytometry, and ELISA. The CCL2 antibody has been shown to inhibit the interaction between CCL2 and its receptor, thereby blocking the recruitment of monocytes and other immune cells to inflammatory sites. It is also nephrotoxic in nature, which means it can cause damage to kidney cells. Additionally, polyclonal antibodies derived from human serum or monoclonal antibodies like adalimumab can be used as alternatives to the CCL2 antibody for specific research purposes.
RPESP antibody
RPESP antibody was raised using the middle region of RPESP corresponding to a region with amino acids LRCSGDGLDSDGNQTLHWQAIGNPRCQGTWKKVRRVDQCSCPAVHSFIFI
MIG protein
Region of MIG protein corresponding to amino acids TPVVRKGRCS CISTNQGTIH LQSLKDLKQF APSPSCEKIE IIATLKNGVQ TCLNPDSADV KELIKKWEKQ VSQKKKQKNG KKHQKKKVLK VRKSQRSRQK KTT.
Purity:Min. 95%GHRH Receptor antibody
The GHRH Receptor antibody is a specific antibody that targets the growth hormone-releasing hormone (GHRH) receptor. It is a monoclonal antibody that has been extensively studied in the field of Life Sciences. This antibody has shown to have neutralizing effects on the GHRH receptor, inhibiting its activity and downstream signaling pathways.
CYP26B1 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of CYP26B1 antibody, catalog no. 70R-3226
Purity:Min. 95%Glyoxalase I antibody
The Glyoxalase I antibody is a neuroprotective glycosylation inhibitor that targets glycopeptides such as transferrin, insulin, and fibronectin. It is widely used in Life Sciences research to study the role of glycosylation in various biological processes. This polyclonal antibody specifically binds to acidic collagens and has been shown to be effective in detecting antiphospholipid antibodies and autoantibodies. Additionally, it can be used as an insulin antibody for studying insulin signaling pathways. The Glyoxalase I antibody is a valuable tool for researchers investigating glycosylation-related mechanisms and can serve as an anticoagulant in certain applications. With its high specificity and sensitivity, this antibody is an essential component of any laboratory working with Polyclonal Antibodies.
ADARB1 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of ADARB1 antibody, catalog no. 70R-1550
Purity:Min. 95%Cytokeratin 16 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of KRT16 antibody, catalog no. 70R-2869
Purity:Min. 95%Haptoglobin Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of HP antibody, catalog no. 70R-5459
Purity:Min. 95%KLK6 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of KLK6 antibody, catalog no. 70R-2466
Purity:Min. 95%PGM3 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of PGM3 antibody, catalog no. 70R-3268
Purity:Min. 95%CPN-267
CPN-267 is a peptide that is an inhibitor of protein interactions. It has been shown to be a potent inhibitor of the activation of the receptor for the amyloid beta peptide. CPN-267 also inhibits ligand binding to the acetylcholine receptor, and blocks ion channels in neuronal cells. This drug has also been shown to inhibit the activity of some proteins involved in cancer cell proliferation and survival. CPN-267 has been used as a research tool for studying protein interactions and has been labeled with fluorochrome to allow for visualization under a microscope.
CAS: 93627-03-3Purity:Min. 95%Nkx2.5 antibody
The Nkx2.5 antibody is a powerful tool used in life sciences research. It is a polyclonal antibody that specifically targets the Nkx2.5 protein, which plays a crucial role in heart development and function. This antibody has been extensively tested and proven to be highly effective in various applications.
Human Fibrinogen ELISA Kit
Please enquire for more information about Human Fibrinogen ELISA Kit including the price, delivery time and more detailed product information at the technical inquiry form on this page
Purity:Min. 95%PNKP Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of PNKP antibody, catalog no. 70R-4477
Purity:Min. 95%Factor XIIIa antibody
Factor XIIIa antibody is a powerful tool used in Life Sciences research for its ability to target and detect Factor XIIIa, an enzyme involved in blood clot formation. This polyclonal antibody specifically binds to Factor XIIIa, allowing researchers to study its role in various biological processes.
EIF4B Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of EIF4B antibody, catalog no. 70R-4927
Purity:Min. 95%SC4MOL antibody
SC4MOL antibody was raised using the N terminal of SC4MOL corresponding to a region with amino acids MATNESVSIFSSASLAVEYVDSLLPENPLQEPFKNAWNYMLNNYTKFQIA
GNB1L Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of GNB1L antibody, catalog no. 70R-1642
Purity:Min. 95%Dog Osteopontin ELISA Kit
Dog Osteopontin ELISA Kit - OPN is confined to the distal parts of a subset of nephrons. In the kidney the expression of OPN is severely upregulated during renal injury.Â
Purity:Min. 95%TSSK2 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of TSSK2 antibody, catalog no. 70R-2083
Purity:Min. 95%Annexin A5 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of ANXA5 antibody, catalog no. 70R-1668Purity:Min. 95%PCBP2 antibody
The PCBP2 antibody is a highly specialized Polyclonal Antibody that has neutralizing properties against enzyme activities. It is commonly used in flow immunoassay techniques to detect and quantify the presence of inhibitory factors in primary cells. This antibody specifically targets the cytokine family, particularly interleukin-6, which plays a crucial role in immune response regulation. The PCBP2 antibody is also effective in inhibiting protease activity and interferon signaling pathways. Its high substrate specificity and strong DNA binding activity make it a valuable tool for researchers studying various cellular processes and molecular interactions. With its exceptional performance and reliability, the PCBP2 antibody is an essential component in any immunological research project.
FOSB antibody
The FOSB antibody is a highly specialized product in the field of Life Sciences. It is designed to target actin filaments that have been activated in various biological systems. This antibody has been extensively tested and proven to be effective in detecting the presence of actin filaments in human serum samples. Additionally, it has shown strong affinity for nuclear actin and has been used successfully in studies involving endothelial growth factors.
09:0 PC
CAS:09:0 PC is a phospholipid that has shown the ability to protect against renal ischemia-reperfusion injury in rats. This protection was seen both in vitro and in vivo, as well as for apoptosis induced by serum deprivation. 09:0 PC was also found to have an anti-inflammatory effect on rat cardiomyocytes. These effects were due to its ability to inhibit phospholipases and neutralize reactive oxygen species (ROS). It has been found that 09:0 PC contains a serine residue at the active site, which may be important for its activity. Further research on the mechanism of 09:0 PC's activity is needed to understand how it protects cells from injury and death.
Formula:C26H52NO8PPurity:Min. 95%Molecular weight:537.67 g/molRef: 3D-CBA86945
Discontinued productCACNA2D4 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of CACNA2D4 antibody, catalog no. 70R-9900
Purity:Min. 95%GAS2L1 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of GAS2L1 antibody, catalog no. 70R-5535
Purity:Min. 95%THC antibody (Gold Colloid)
THC antibody (Gold Colloid) was raised in mouse using tetrahydrocannabinol (THC) as the immunogen.Purity:Min. 95%UST Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of UST antibody, catalog no. 70R-1825
Purity:Min. 95%CACNB2 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of CACNB2 antibody, catalog no. 70R-5076
Purity:Min. 95%GPX3 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of GPX3 antibody, catalog no. 70R-5305
Purity:Min. 95%MPP7 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of MPP7 antibody, catalog no. 70R-2195
beta Tubulin antibody
The beta Tubulin antibody is a highly specialized antibody that targets the beta tubulin protein. This protein plays a crucial role in cell division and is essential for the formation of microtubules, which are involved in various cellular processes. The beta Tubulin antibody has been extensively studied and proven to be effective in detecting and quantifying beta tubulin in various biological samples.
ATG16L1 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of ATG16L1 antibody, catalog no. 70R-2320
Purity:Min. 95%JAK2 antibody
The JAK2 antibody is a highly specialized insulin antibody that is designed to target and neutralize the activity of the Janus kinase 2 (JAK2) protein. This protein plays a crucial role in the signaling pathway of insulin, which regulates blood sugar levels in the body. By blocking the activity of JAK2, this antibody helps to improve insulin sensitivity and control glucose metabolism.Purity:Min. 95%KCNH7 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of KCNH7 antibody, catalog no. 70R-5110
Purity:Min. 95%BRF1 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of BRF1 antibody, catalog no. 20R-1153
Purity:Min. 95%RAE1 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of RAE1 antibody, catalog no. 70R-4676
Purity:Min. 95%MFRP Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of MFRP antibody, catalog no. 70R-6525
Purity:Min. 95%SH3BGRL Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of SH3BGRL antibody, catalog no. 70R-3848
Purity:Min. 95%MRGPRX4 antibody
The MRGPRX4 antibody specifically targets the Mas-related G protein-coupled receptor X4 (MRGPRX4), a GPCR encoded by the MRGPRX4 gene. This receptor is primarily expressed in human tissues, including sensory neurons and skin keratinocytes. Functionally, the activation of the receptor by specific ligands can trigger itch sensations, and it may also play a role in nociception. Researchers commonly use MRGPRX4 antibodies for techniques such as immunohistochemistry (IHC), Western blot (WB), and immunocytochemistry (ICC/IF) to study their expression and localization. Notably, these antibodies have undergone rigorous validation to ensure specificity. Furthermore, recent research highlights the role of MRGPRX4 in cholestatic itch, where bile acids act as natural ligands for this receptor. These findings provide a promising new drug target for anti-itch therapies.
AGGF1 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of AGGF1 antibody, catalog no. 70R-3986
Purity:Min. 95%PARP12 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of PARP12 antibody, catalog no. 70R-3371
Purity:Min. 95%CPSF2 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of CPSF2 antibody, catalog no. 70R-4865
Purity:Min. 95%CDK2 antibody
The CDK2 antibody is a monoclonal antibody that is widely used in Life Sciences research. It is specifically designed to target and bind to cyclin-dependent kinase 2 (CDK2), an enzyme involved in cell cycle regulation. This antibody has been extensively validated for use in various assays, including Western blotting, immunohistochemistry, and immunofluorescence.
RARA Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of RARA antibody, catalog no. 70R-4609
Purity:Min. 95%PVRL2 antibody
The PVRL2 antibody is a highly specialized antibody that targets the PVRL2 protein. This protein plays a crucial role in various biological processes, including cell adhesion, immune response, and signal transduction. The PVRL2 antibody has been extensively studied and proven to be effective in research applications related to echinococcus, tyrosine kinase-like activity, phosphatase activity, arginase activity, actin filament organization, and circumsporozoite protein interactions.
ZBTB26 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of ZBTB26 antibody, catalog no. 70R-8354
Purity:Min. 95%LRRC17 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of LRRC17 antibody, catalog no. 70R-4120
Purity:Min. 95%SPRYD3 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of SPRYD3 antibody, catalog no. 70R-10146
Purity:Min. 95%Rheumatoid Factor IgA ELISA kit
ELISA kit for the detection of Rheumatoid Factor IgA in the research laboratory
Purity:Min. 95%GB 83
CAS:GB 83 is a nutritional supplement that is used to support the immune system and improve health. It contains conjugates of glutathione and glycine, which are both important for detoxification. GB 83 also contains methyl ketones that have been shown to inhibit protease activity in urine samples. This product has been shown to be effective in diagnosing herpes simplex virus (HSV) and eucaryotic organisms. The diagnostic properties of GB 83 are due to its ability to activate toll-like receptor 4 (TLR4).
Formula:C32H44N4O4Purity:Min. 95%Molecular weight:548.7 g/molRef: 3D-CAC80686
Discontinued productWNT11 antibody
The WNT11 antibody is a highly specialized product that plays a crucial role in the field of Life Sciences. This antibody specifically targets the amino group and acts as a growth factor, promoting cellular development and function.
ZNF441 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of ZNF441 antibody, catalog no. 20R-1181
Purity:Min. 95%IARS2 antibody
The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the class of rifamycins. It is highly effective in treating tuberculosis infections as it contains active compounds with bactericidal activity. This drug works by binding to DNA-dependent RNA polymerase, inhibiting bacterial growth and preventing transcription and replication. Its efficacy has been proven through extensive testing using the patch-clamp technique on human erythrocytes. The metabolization of this drug involves various metabolic transformations, including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, 6-Fluoro-3-indoxyl-beta-D-galactopyranoside specifically targets markers expressed at high levels in Mycobacterium tuberculosis strains and effectively inhibits cell growth in culture.
Transglutaminase 2 antibody
Transglutaminase 2 antibody is a highly specialized monoclonal antibody that targets the transglutaminase 2 protein. This protein plays a crucial role in various cellular processes, including apoptosis, cell adhesion, and signal transduction. The antibody specifically recognizes and binds to transglutaminase 2, inhibiting its enzymatic activity.
FBXO24 antibody
FBXO24 antibody was raised using the middle region of FBXO24 corresponding to a region with amino acids EGKIYSLVVNETQLDQPRSYTVQLALRKVSHYLPHLRVACMTSNQSSTLY
TBC1D1 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of TBC1D1 antibody, catalog no. 70R-2415
Purity:Min. 95%HSPA8 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of HSPA8 antibody, catalog no. 70R-4109
Purity:Min. 95%EXOSC2 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of EXOSC2 antibody, catalog no. 70R-1344
Purity:Min. 95%TRABD Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of TRABD antibody, catalog no. 70R-3719
Purity:Min. 95%C5ORF35 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of C5orf35 antibody, catalog no. 70R-4192
Purity:Min. 95%Rabbit CRP ELISA Kit
C-reactive protein (CRP) is a substance produced by the liver in response to inflammation. It is a marker of inflammation in the body and is often used in medical settings to assess the presence and severity of inflammation. CRP levels can rise in response to various conditions, including infections, injuries, and chronic inflammatory diseases.
High levels of CRP in the blood can indicate the presence of inflammation, but it doesn't pinpoint the exact cause. It is commonly used in combination with other clinical and laboratory findings to help diagnose and monitor conditions such as infections, autoimmune diseases, and cardiovascular diseases. Elevated CRP levels may also be associated with conditions like rheumatoid arthritis, inflammatory bowel disease, and certain cancers.Purity:Min. 95%TXNDC4 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of TXNDC4 antibody, catalog no. 70R-3581
Purity:Min. 95%CTGF protein
CTGF protein is a nephrotoxic monoclonal antibody that targets alpha-fetoprotein. It belongs to the group of Recombinant Proteins & Antigens and acts as a growth factor. CTGF protein binds to TGF-β1, a key regulator of cell growth and differentiation, and inhibits its activity. This inhibition leads to a decrease in collagen production, which is important for tissue repair and remodeling. CTGF protein has cytotoxic effects on human serum and can induce apoptosis in certain cell types. Additionally, it has been shown to interact with other growth factors such as epidermal growth factor and histidine amide, further enhancing its biological effects.
Purity:Min. 95%RIOK2 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of RIOK2 antibody, catalog no. 70R-3721
Purity:Min. 95%DDX39 antibody
The DDX39 antibody is a valuable tool used in immunoassays within the Life Sciences field. It specifically targets and binds to isolated nucleic acids, collagen, trastuzumab, and other important molecules. This antibody can be used in both polyclonal and monoclonal forms, allowing for versatile applications in various research settings.
TADA1L antibody
TADA1L antibody was raised using a synthetic peptide corresponding to a region with amino acids REVIPTHTVYALNIERIITKLWHPNHEELQQDKVHRQRLAAKEGLLLC
SPDP-dPEG®12-Acid
CAS:SPDP-dPEG®12-Acid is a PEG compound with two different functional groups (also known as heterobifunctional). Unlike homobifunctional PEG compounds (same functional group on both ends), this type of compounds are more versatile as have two different anchor points. SPDP-dPEG®12-Acid is used as a linker and spacer to add a PEG moiety, via pegylation (a bioconjugation technique) to proteins, peptides, oligonucleotides, small molecules and nanoparticles.
Formula:C38H62N4O17Purity:Min. 95%Molecular weight:846.92 g/molSSX1 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of SSX1 antibody, catalog no. 70R-9559
Purity:Min. 95%WDR54 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of WDR54 antibody, catalog no. 70R-10100
Purity:Min. 95%SNRP70 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of SNRP70 antibody, catalog no. 70R-1431
Purity:Min. 95%WT1 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of WT1 antibody, catalog no. 70R-8233
Purity:Min. 95%RAB39B Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of RAB39B antibody, catalog no. 70R-5833
Purity:Min. 95%TAF3 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of TAF3 antibody, catalog no. 70R-9077
Purity:Min. 95%Dengue Virus IgM ELISA kit
ELISA kit for the detection of Dengue Virus IgM in the research laboratory
Purity:Min. 95%C9orf64 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of C9orf64 antibody, catalog no. 70R-10060
Purity:Min. 95%CHRND antibody
CHRND antibody was raised in rabbit using the N terminal of CHRND as the immunogen
Purity:Min. 95%GNAI1 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of GNAI1 antibody, catalog no. 70R-2047
Purity:Min. 95%MAP4K4 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of MAP4K4 antibody, catalog no. 70R-5785
Purity:Min. 95%Albumin Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of ALB antibody, catalog no. 70R-5386
Purity:Min. 95%Mouse α 1-Antitrypsin ELISA Kit
Please enquire for more information about Mouse Alpha 1-Antitrypsin ELISA Kit including the price, delivery time and more detailed product information at the technical inquiry form on this page
Purity:Min. 95%FBXO16 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of FBXO16 antibody, catalog no. 70R-3782
Purity:Min. 95%TADA2L Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of TADA2L antibody, catalog no. 70R-7986
Purity:Min. 95%Monkey Albumin ELISA Kit
Please enquire for more information about Monkey Albumin ELISA Kit including the price, delivery time and more detailed product information at the technical inquiry form on this page
Purity:Min. 95%Nestin Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of NES antibody, catalog no. 70R-5230
Purity:Min. 95%
