Biochemicals and Reagents

A synthetic peptide for use as a blocking control in assays to test for specificity of NR4A3 antibody, catalog no. 70R-3103

Affinity purified Rabbit polyclonal NGF beta antibody

INTS9 antibody was raised in Rabbit using Human INTS9 as the immunogen

A synthetic peptide for use as a blocking control in assays to test for specificity of GPSM2 antibody, catalog no. 70R-2234

Quantify total bovine IgM in your samples.

A synthetic peptide for use as a blocking control in assays to test for specificity of SOHLH1 antibody, catalog no. 70R-3390

OR13C9 antibody was raised in rabbit using the middle region of OR13C9 as the immunogen

A synthetic peptide for use as a blocking control in assays to test for specificity of DNAJB11 antibody, catalog no. 70R-7353

Affinity purified Rabbit polyclonal TTC1 antibody

AFP antibody was raised in Rabbit using Human AFP as the immunogen

NHP2L1 antibody was raised in Rabbit using Human NHP2L1 as the immunogen

CACNG6 antibody was raised using the N terminal of CACNG6 corresponding to a region with amino acids RAHGQGRSGLTPEREGKVKLALLLAAVGATLAVLSVGTEFWVELNTYKAN

3,5-Dimethylacetildenafil is a research tool that can be used as an activator or ligand to study the function of receptors and ion channels. It also has potential in the treatment of cardiovascular diseases. 3,5-Dimethylacetildenafil binds to and activates the receptor for nitric oxide (iNOS). The activation of this receptor leads to vasodilation and increased blood flow. This drug is also an inhibitor of phosphodiesterase type 5 (PDE5), which is responsible for breaking down cGMP, thereby regulating smooth muscle tone in penile tissue. 3,5-Dimethylacetildenafil has been shown to inhibit the enzyme activity of protein kinases by binding to ATP and preventing it from converting into ADP.

A synthetic peptide for use as a blocking control in assays to test for specificity of SLC43A1 antibody, catalog no. 70R-6331

A synthetic peptide for use as a blocking control in assays to test for specificity of BRF2 antibody, catalog no. 70R-8950

This product is a Substance P antagonist and is available as a 0.5mg vial. Substance P is a neuropeptide that is involved in the transmission of pain signals and inflammation. It is a member of the tachykinin neuropeptide family and is produced in the central nervous system and acts through its specific receptor neurokinin 1 receptor (NK-1R). NK-1R is present in neurons and on glial cell types. Substance P is involved in: pain perceptions as a neurotransmitter; gut motility; increased inflammation in the lungs, gastrointestinal tract and the skin and neuroinflammation. Interestingly the levels of Substance P are raised in inflammatory bowel diseases and through its involvement in cytokine release, it contributes to asthma pathology. These diverse selection of functions makes substance P a target for therapeutic research.

L-Atabrine is a drug that inhibits the binding of the antibody. It is used as a research tool to study cell biology, peptides and pharmacology. L-Atabrine has been shown to be an activator of ion channels and high purity. It also binds to receptors with high affinity.

Mycoplasma pneumonia protein is a recombinant protein that is commonly used in the field of life sciences. It is a monoclonal antibody that specifically targets the Mycoplasma pneumoniae bacteria, which is known to cause respiratory infections in humans. This protein can be activated and used for various applications, such as studying the role of Mycoplasma pneumoniae in disease development or testing the effectiveness of potential inhibitors or antibodies against this pathogen. Additionally, Mycoplasma pneumonia protein has been shown to have interactions with other molecules, including alpha-fetoprotein and adeno-associated virus, making it a valuable tool for researchers working in these areas. Its versatility and specificity make it an essential component in many studies related to infectious diseases and immunology.

A synthetic peptide for use as a blocking control in assays to test for specificity of MAGEA9 antibody, catalog no. 20R-1203

Affinity purified Rabbit polyclonal RPL14 antibody

A synthetic peptide for use as a blocking control in assays to test for specificity of G22P1 antibody, catalog no. 70R-1051

IL4 antibody is a glycoprotein that belongs to the class of monoclonal antibodies. It is commonly used in life sciences research and has various applications in the field. IL4 antibody can be used as a tool to study the role of interleukin-4 (IL-4) in immune responses and inflammation. It can also be used as an inhibitor to block the activity of IL-4, which is involved in anti-angiogenesis and other processes.

ATP1B3 antibody was raised in Rabbit using Human ATP1B3 as the immunogen

A synthetic peptide for use as a blocking control in assays to test for specificity of Ascc1 antibody, catalog no. 70R-9441

A synthetic peptide for use as a blocking control in assays to test for specificity of EIF4G3 antibody, catalog no. 70R-4871

The IL10 antibody is a powerful cytotoxic agent used in Life Sciences research. It is an antibody that specifically targets and binds to interleukin-10 (IL-10), a cytokine involved in immune regulation. This antibody can be conjugated with cytotoxic agents to create a cytotoxic conjugate, which can selectively kill cells expressing IL-10 receptors.

A synthetic peptide for use as a blocking control in assays to test for specificity of LOC344065 antibody, catalog no. 70R-9046

Ldn 212854 is a novel small molecule that has been shown to promote the regeneration of epithelial cells in a population of organoids. In addition, this drug has been shown to increase the size and number of regenerative epithelial cells in cell preparations. Ldn 212854 has also been demonstrated to have therapeutic potential for regenerative medicine. It may be used as an alternative treatment for skin damage or other epithelial-related conditions. This drug is currently being researched for its applications in the field of regenerative medicine.

A synthetic peptide for use as a blocking control in assays to test for specificity of RNF31 antibody, catalog no. 70R-2801

A synthetic peptide for use as a blocking control in assays to test for specificity of ACPP antibody, catalog no. 70R-5707

L-745870 is a drug that has been shown to have an inhibitory effect on monoamine neurotransmitter levels. It is currently being investigated as a potential treatment for symptoms of Parkinson's disease. L-745870 binds to the oxytocin receptor and inhibits serine protease activity, thereby reducing the production of dopamine and other monoamines. In humans, L-745870 has been shown to increase locomotor activity in doses that do not cause any adverse side effects. The effective dose for L-745870 is 10 mg/kg, and it reaches its maximal response at 60 minutes after administration. This drug also has an excellent profile with regard to pharmacokinetics and safety.

Rabbit polyclonal ABL1/2 antibody

A synthetic peptide for use as a blocking control in assays to test for specificity of CLCA2 antibody, catalog no. 70R-8069

A synthetic peptide for use as a blocking control in assays to test for specificity of TUSC4 antibody, catalog no. 70R-8927

Rabbit polyclonal MED17 antibody

Purified recombinant JO1 protein

Sheep IgM is a monoclonal antibody that is widely used in Life Sciences research. It plays a crucial role in various cellular processes, including the regulation of β-catenin and caspase-9. Sheep IgM also activates the mitogen-activated protein (MAP) signaling pathway, which is involved in cell proliferation, differentiation, and survival. This antibody has antiviral properties and can be used in immunoassays to detect specific antigens. Additionally, Sheep IgM has been shown to activate p38 MAP kinase and endonuclease activity. Purified Immunoglobulins derived from sheep have an acidic pH, making them suitable for use in a wide range of applications. Overall, Sheep IgM is a valuable tool for researchers studying various aspects of cell biology and immunology.

SCYL1 antibody was raised in rabbit using the C terminal of SCYL1 as the immunogen

PRPF6 antibody was raised using a synthetic peptide corresponding to a region with amino acids PGKRTVGDQMKKNQAADDDDEDLNDTNYDEFNGYAGSLFSSGPYEKDDEE

RORA antibody was raised using the middle region of RORA corresponding to a region with amino acids  GHTPEGSKADSAVSSFYLDIQPSPDQSGLDINGIKPEPICDYTPASGFFP

ELISA kit for detection of Laminin in the research laboratory

NSC 636819 is a histone deacetylase (HDAC) inhibitor that is used in cancer research. This drug has been shown to inhibit homologous recombination and growth factor-induced DNA repair by blocking the binding of HDAC1 to the substrate, thereby preventing histone deacetylation and reversing the effects of tumor suppressor genes. NSC 636819 also inhibits 2-hydroxyglutarate production, which leads to a higher rate of homologous recombination, leading to cell death. The administration of this drug has been shown to increase tumor size in mouse models with an IDH2 mutation. In addition, NSC 636819 has been shown to be effective in inhibiting cell proliferation in enteroendocrine cells and immunostaining for tgf-β.

This antibody reacts with heavy chains on human IgA (alpha chain) and.

N terminal of murine Adipophillin.

Goat anti-Guinea Pig IgG (H + L) was raised in goat using purified Guinea Pig IgG (H&L) as the immunogen.

A synthetic peptide for use as a blocking control in assays to test for specificity of HSPB8 antibody, catalog no. 70R-2327

Peptide H-VMTPRTLLL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

A synthetic peptide for use as a blocking control in assays to test for specificity of UBE2N antibody, catalog no. 70R-1147

Rabbit polyclonal PKC alpha beta 2 antibody

Rabbit polyclonal Casein kinase 2 antibody

Primary SIL peptide for Emicizumab  detection and quantification

CD16 antibody (biotin) was raised in rat using murine CD16/32 (CD16/Fc gamma II and CD32/Fc gamma III receptors)

Rabbit polyclonal GABRG2 antibody

ELISA Kit for detection of CX3CL1 in the research laboratory

A synthetic peptide for use as a blocking control in assays to test for specificity of SEMA4F antibody, catalog no. 70R-6852

Androgen receptor antagonist; has therapeutic application in prostate cancer

ANPEP antibody was raised in Rabbit using Human ANPEP as the immunogen

A synthetic peptide for use as a blocking control in assays to test for specificity of RAB40B antibody, catalog no. 70R-5856

ALDH1B1 antibody was raised in Rabbit using Human ALDH1B1 as the immunogen

Rimtuzalcap is a monoclonal antibody, which is derived from a hybridoma technology involving the fusion of specific immune cells. It operates through the highly specific binding to a targeted antigen, thereby modulating immune responses or interfering with signaling pathways. This precision in action enhances its efficacy and minimizes off-target effects compared to broader immunomodulatory agents.

A synthetic peptide for use as a blocking control in assays to test for specificity of C21orf66 antibody, catalog no. 70R-8730

Affinity purified Rabbit polyclonal GCLC antibody

Affinity purified Rabbit polyclonal VATPase a4 antibody

A synthetic peptide for use as a blocking control in assays to test for specificity of CYP3A7 antibody, catalog no. 70R-1867

The SMYD3 antibody is a highly specialized monoclonal antibody used in the field of Life Sciences. It is designed to specifically target and bind to the SMYD3 protein, which is primarily found in the nucleus of cells. This immobilized antibody can be used for various applications, including research studies and diagnostic purposes.

A synthetic peptide for use as a blocking control in assays to test for specificity of CFP antibody, catalog no. 70R-5909

The PDIA4 antibody is a highly specialized monoclonal antibody used in the field of Life Sciences. It is designed to target and bind to the PDIA4 antigen, which is an extracellular enzyme involved in various cellular processes. This antibody has been extensively tested and proven to be effective in detecting and quantifying PDIA4 levels in human serum samples.

AMY2A antibody was raised in Rabbit using Human AMY2A as the immunogen

NSC 162535 disodium is a synthetic compound, classified as a chemical agent. It is derived from chemical synthesis processes intended for research and experimental purposes. The compound acts through biochemical interactions that affect specific cellular pathways, making it of interest for a variety of investigative biological studies.

IL3 antibody was raised in rabbit using highly pure recombinant murine IL-3 as the immunogen.

A synthetic peptide for use as a blocking control in assays to test for specificity of OR1D2 antibody, catalog no. 70R-9850

YM 53601 is a non-hydrolyzable analogue of the natural statin drug pravastatin. YM 53601 inhibits cholesterol synthesis by binding to the hydroxymethylglutaryl coenzyme A reductase (HMGCR) enzyme, which is involved in the conversion of HMG-CoA to mevalonate, a precursor of cholesterol. It has been shown to inhibit the replication of viruses such as HIV and influenza in animal models. YM 53601 also inhibits cell proliferation and induces apoptosis in cancer cells, as well as inhibiting fatty acid synthase and reducing levels of fatty acids in liver cells. In humans, it has been shown that YM 53601 binds to the receptor that activates adenylate cyclase and reduces cellular levels of cAMP. This inhibition has been linked to its ability to reduce inflammation and protect against cardiovascular disease.

Acyl 06:0 NBD pa is a fluorescent analog of the lipid-signaling molecule acyl 06:0 NBD. It can be used to study protein interactions and signaling in cells by labeling proteins, peptides, and antibodies with this fluorescent molecule. The fluorophore has an excitation maximum at 458 nm and emission maximum at 505 nm. Acyl 06:0 NBD pa is also used as a research tool in cell biology, specifically for ion channels, receptor ligand binding, activation, and inhibition studies.

Des-Asp1-[Ile8]-Angiotensin II is a peptide that has been shown to have analgesic effects. It has been reported to be active in anesthetized, Sprague-Dawley rats and in primary cultures of rat brain neurons. The peptide binds to the angiotensin II type 1 receptor (AT1) subtype and enhances the activity of the receptor when it is bound by angiotensin II. Des-Asp1-[Ile8]-Angiotensin II also inhibits aminopeptidase activity, leading to an increase in the concentration of angiotensin II. This leads to increased antinociception at high concentrations, which may be due to its effect on baroreceptors or mesenteric blood vessels.

Mouse monoclonal Granulocytes antibody (FITC)

A synthetic peptide for use as a blocking control in assays to test for specificity of DDEFL1 antibody, catalog no. 70R-3553

A synthetic peptide for use as a blocking control in assays to test for specificity of Coro2b antibody, catalog no. 70R-9147

A synthetic peptide for use as a blocking control in assays to test for specificity of S100A9 antibody, catalog no. 70R-5716

The Lactadherin antibody is a powerful tool used in the field of Life Sciences. This antibody has shown to have cytotoxic effects on tumor cells and can inhibit the growth of microvessels, which are essential for tumor development. It specifically targets TNF-α, a cytokine involved in inflammation and immune response. The Lactadherin antibody can be used in combination with other antibodies, such as adalimumab, to enhance its therapeutic effects. It works by activating protein kinases and phosphatases, which regulate cell growth and survival pathways. Whether you need a polyclonal or monoclonal antibody, the Lactadherin antibody is an excellent choice for your research needs.

ELISA Kit for detection of PDGFAB in the research laboratory

A synthetic peptide for use as a blocking control in assays to test for specificity of ETV1 antibody, catalog no. 70R-7876

3-Chloro-N-(1-cyclohexyl-3-methyl-1H-pyrazol-5-yl)-4-fluoro­benzeneacetamide is a potent and selective inhibitor of the insulin receptor. It binds to the extracellular domain of the insulin receptor, preventing it from binding to its ligands. The inhibition of the insulin receptor leads to a reduction in glucose uptake and an increase in glycogen synthesis. This agent also inhibits ion channels such as voltage gated sodium channels. 3-Chloro-N-(1-cyclohexyl-3-methyl-1H­ pyrazol­5­yl)-4­fluoro­benzeneacetamide has been shown to act as an agonist at alpha2A adrenergic receptors, leading to increased blood pressure.

ATP6V1A antibody was raised in Rabbit using Human ATP6V1A as the immunogen

Imiglitazar is a drug that inhibits the activity of phosphodiesterase 4 (PDE4), an enzyme that breaks down cAMP. This leads to increased levels of cAMP, which has been shown to have beneficial effects on inflammatory bowel disease, chronic pulmonary disease, and congestive heart failure. Imiglitazar is also used as a diagnostic marker for these conditions.

LSM10 antibody was raised in Rabbit using Human LSM10 as the immunogen

A synthetic peptide for use as a blocking control in assays to test for specificity of KIF23 antibody, catalog no. 70R-5550

CKB antibody was raised in Rabbit using Human CKB as the immunogen

A synthetic peptide for use as a blocking control in assays to test for specificity of A4GALT antibody, catalog no. 70R-7417

A synthetic peptide for use as a blocking control in assays to test for specificity of FAM90A1 antibody, catalog no. 70R-4363

A synthetic peptide for use as a blocking control in assays to test for specificity of PSD3 antibody, catalog no. 70R-1226

A synthetic peptide for use as a blocking control in assays to test for specificity of CST9 antibody, catalog no. 70R-6727

A synthetic peptide for use as a blocking control in assays to test for specificity of DFFA antibody, catalog no. 20R-1064

Affinity purified Rabbit polyclonal HPS6 antibody

Affinity purified Rabbit polyclonal LOC80129 antibody

2-Butyl-4,5-dihydro-4-oxo-3-((2'-(1H-tetrazol-5-yl)-4biphenylyl)methyl)-3Himidazo(4,5-C)pyridine (BBTTP) is a research tool to study the function of ion channels and receptors. It binds to the receptor site on the cell membrane and activates it. BBTTP can also be used as a ligand to identify other ligands that bind to the same receptor site. This compound has been shown to inhibit protein interactions in cells, which may lead to new treatments for diseases such as Alzheimer's disease or cancer.

Rabbit polyclonal ZAP70 antibody (Tyr319)

A synthetic peptide for use as a blocking control in assays to test for specificity of CLN6 antibody, catalog no. 70R-6557

The TRPA1 antibody is a highly specialized antibody used in Life Sciences research. It is designed to specifically target and bind to the TRPA1 protein, which plays a crucial role in various physiological processes. This antibody has been extensively tested and validated for use in techniques such as immunohistochemistry, Western blotting, and immunofluorescence.

MLK3 inhibitor

A synthetic peptide for use as a blocking control in assays to test for specificity of TWF1 antibody, catalog no. 70R-3895

Purified Polyclonal ROR gamma antibody

Leptin is a hormone that regulates energy metabolism by modulating appetite and body weight. Leptin is produced by fat cells and signals to the hypothalamus of the brain about how much fat tissue there is. It also helps regulate other metabolic processes, such as insulin resistance and glucose tolerance. Leptin has been shown to have an anorectic effect in rodents, which may be due to its ability to reduce food intake or increase energy expenditure. In humans, leptin levels are higher in obese individuals than in those with normal weight, which indicates that this hormone may play a role in obesity.

NAGS antibody was raised using the C terminal of NAGS corresponding to a region with amino acids YLDKFVVSSSRQGQGSGQMLWECLRRDLQTLFWRSRVTNPINPWYFKHSD

ZNF548 antibody was raised in rabbit using the N terminal of ZNF548 as the immunogen

LY 266097 Hydrochloride is a selective 5-HT2A receptor antagonist, which is a synthetic compound primarily used in neuroscience research. This compound is derived from laboratory synthesis, designed to interact specifically with serotonin receptors located in the central nervous system.

DNM3 antibody was raised in Rabbit using Human DNM3 as the immunogen

Affinity purified Rabbit polyclonal alpha Tubulin 4a antibody

The CD29 antibody is a highly effective monoclonal antibody that has multiple applications in the field of biotechnology. It can be used as a growth factor, a cdk4/6 inhibitor, and an antiviral agent. The CD29 antibody contains excipients such as globulin, which enhance its stability and efficacy. This powerful antibody has neutralizing properties and can effectively target molecules involved in various biological processes.

Rabbit polyclonal HLAB antibody

ACADVL antibody was raised in Rabbit using Human ACADVL as the immunogen

DHX58 antibody was raised using a synthetic peptide corresponding to a region with amino acids AYVAKRHLETVDGAKVVVLVNRVHLVTQHGEEFRRMLDGRWTVTTLSGDM

A synthetic peptide for use as a blocking control in assays to test for specificity of CALCR antibody, catalog no. 70R-9835

A synthetic peptide for use as a blocking control in assays to test for specificity of SAP30BP antibody, catalog no. 20R-1212

Anti ATP Receptor P2X4 (370-388) (Rat) Serum is an antibody that binds to the extracellular domain of the P2X4 receptor. The antibody has been shown to inhibit the ATP-induced increase in intracellular calcium levels. It is a research tool for studying the function of P2X4 receptors and ion channels. It is also used as an inhibitor in pharmacology, cell biology, and protein interactions. Anti ATP Receptor P2X4 (370-388) (Rat) Serum has a CAS number of 12056-07-8.

Recombinant human MRAS protein (His tag)

CISD2 antibody was raised in Rabbit using Human CISD2 as the immunogen

A synthetic peptide for use as a blocking control in assays to test for specificity of WDHD1 antibody, catalog no. 70R-7950

A synthetic peptide for use as a blocking control in assays to test for specificity of SQLE antibody, catalog no. 70R-1955

A synthetic peptide for use as a blocking control in assays to test for specificity of Cdx1 antibody, catalog no. 70R-8239

DO-11.10 T cell Receptor Monoclonal Antibody (RPE)

Rabbit polyclonal BLZF1 antibody

A synthetic peptide for use as a blocking control in assays to test for specificity of FAM118A antibody, catalog no. 70R-4554

The GSTO1 antibody is a highly specialized antibody that targets specific proteins and molecules in the body. It has been extensively studied for its ability to interact with various substances, including anti-ACTH antibodies, adiponectin, annexin, and adiponectin receptor. The GSTO1 antibody has also been found to inhibit the activity of family kinase inhibitors and fibrinogen.

A synthetic peptide for use as a blocking control in assays to test for specificity of HAPLN2 antibody, catalog no. 70R-9514

Sphingosine-1-phosphate (S1P) is a bioactive lipid that is synthesized from sphingosine by the enzyme sphingosine kinase. This molecule is involved in many cellular processes, including cell proliferation and differentiation. The S1P D7 isotopologue is an isotopically enriched form of S1P that can be used for quantitative analysis of S1P metabolism. Sphingosine-1-phosphate D7 has been shown to induce neuroinflammation via upregulation of IL-6, TNFα and IL-8 expression in microglia cells. It also alters the expression of genes related to neuronal function and development, such as transcriptase polymerase chain reaction (PCR), neuron, and acute lung. Sphingosine-1-phosphate D7 also induces mitochondrial dysfunction and oxidative stress in fibroblast cells.

The CKS2 antibody is a highly specialized monoclonal antibody used in the field of Life Sciences. It is designed to target and neutralize the toxic effects of colony-stimulating factors, which are proteins that regulate the production and differentiation of white blood cells. The CKS2 antibody specifically targets the phosphatase activity of colony-stimulating factors, inhibiting their ability to stimulate cell growth and division.

A synthetic peptide for use as a blocking control in assays to test for specificity of KHDRBS1 antibody, catalog no. 70R-5677

Rabbit polyclonal GSK3 alpha/beta antibody

A synthetic peptide for use as a blocking control in assays to test for specificity of DAZAP1 antibody, catalog no. 70R-4724

A synthetic peptide for use as a blocking control in assays to test for specificity of TRAPPC2 antibody, catalog no. 70R-8937

Peptide H-LQAR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

A synthetic peptide for use as a blocking control in assays to test for specificity of LOXL1 antibody, catalog no. 70R-5381

6-Oxoestriol (carboxymethyl)oxime is a synthetic estrogen. It is a water-soluble compound that can be stored at room temperature in the dark. This drug binds with high affinity to mammalian serum albumin, and has an elimination half-life of 2 hours. The binding constants for 6-oxoestriol (carboxymethyl)oxime and serum albumin are greater than 10,000 M-1. 6-Oxoestriol (carboxymethyl)oxime binds to the estrogen receptor, which mediates its effects on the uterus, mammary gland, and pituitary gland. 6-Oxoestriol (carboxymethyl)oxime is used therapeutically as a replacement for estrogen in cases of hypogonadism or menopause. This drug is also used experimentally to study the role of estrogen receptors in various tissues.

CD45 antibody (FITC) was raised in Rat using as exon C-dependent epitope of CD45 glycoprotin as the immunogen.

CFL1 antibody was raised in Rabbit using Human CFL1 as the immunogen

A synthetic peptide for use as a blocking control in assays to test for specificity of RAB26 antibody, catalog no. 70R-5815

CD24 antibody (Azide Free) was raised in rat using murine heat stable antigen as the immunogen.

MCOPPB is a novel analgesic that has been shown to have antinociceptive properties in vivo. This compound has also been shown to have an effect on locomotor activity, as well as analgesic effects in chronic neuropathic pain models. MCOPPB is a novel chemical entity and acts at the μ-opioid receptor, which is different from other known opioids. The clinical data for this drug show that it has potential for the treatment of chronic pain syndromes, such as neuropathic pain. MCOPPB also has an agonistic effect on the δ-opioid receptor, which may be responsible for its ability to reduce pain hypersensitivity.

A synthetic peptide for use as a blocking control in assays to test for specificity of HRK antibody, catalog no. 70R-6345

Affinity purified Rabbit polyclonal AHCYL2 antibody

SNIPER(ABL)-033 is an advanced biotechnological tool designed to facilitate targeted research interventions. It is sourced from a collaborative effort between molecular biology specialists and biochemical engineers, ensuring robustness in complex biological environments. The product operates via advanced Antibody-Based Ligand (ABL) technology, which allows for the precise targeting and modulation of specific cellular pathways. Its mode of action involves binding to distinct molecular markers, facilitating targeted interference or activation of biological processes with high specificity and minimized off-target effects.

CMVpp65 - 64 is a custom research peptide; min purity 95%, TFA salt. For different specs please use the Peptide Quote Tool

Goat anti-human IgG was raised in goat using human IgG F(c) fragment as the immunogen.

Rabbit polyclonal COMMD4 antibody

Centromere protein B (CENP-B) is a protein that belongs to the histone H3 family. It is one of the proteins involved in regulating chromosome segregation during mitosis and meiosis. CENP-B has been shown to be involved in the activation of kinetochores, which are structures on the surface of chromosomes that attach to microtubules and help with mitotic chromosome movement. Centromere protein B can also be used as a ligand or receptor, or a tool for cell biology, immunology, and pharmacology research.

The Matrilysin protein is a vital component in the field of Life Sciences. It plays a significant role in various biological processes and has been extensively studied for its diverse functions. This protein contains tyrosine residues that are crucial for its activity and interaction with other molecules such as vitronectin.

Affinity purified Rabbit polyclonal DNA ligase 3 antibody

The S-100ß ELISA kit is a solid phase sandwich enzyme-linked immunosorbent assay (ELISA) that detects the presence of S-100ß protein in serum, plasma, or cerebrospinal fluid. The assay employs an antibody specific for S-100ß protein and an enzyme-labeled anti-IgG antibody as a second antibody to detect bound S-100ß protein.

LPHN3 antibody was raised in Rabbit using Human LPHN3 as the immunogen

Affinity purified Rabbit polyclonal PAK6 antibody

A synthetic peptide for use as a blocking control in assays to test for specificity of RPA1 antibody, catalog no. 70R-5545

Hexa-His is a monoclonal antibody that binds to the glycoprotein of human herpes simplex virus. It is used for the diagnosis of this virus in patients with symptoms of genital herpes and for identifying the type of herpes simplex virus in tissue culture. Hexa-His has been shown to be effective against cancers such as melanoma, ovarian cancer, and prostate cancer. This antibody also has been shown to be effective against inflammatory diseases such as Crohn's disease, rheumatoid arthritis, and psoriasis.

The GPR158 antibody is a monoclonal antibody that specifically targets GPR158, a cationic receptor involved in various biological processes. This antibody has been extensively tested and validated for its specificity and effectiveness in scientific research. It can be used in a wide range of applications, including immunohistochemistry, Western blotting, and ELISA.

A synthetic peptide for use as a blocking control in assays to test for specificity of DAZ3 antibody, catalog no. 70R-4845

A synthetic peptide for use as a blocking control in assays to test for specificity of MPPE1 antibody, catalog no. 70R-7157

2-(2-(4-Methylpiperazin-1-yl)quinazolin-4-yl)acetamide is a potent inhibitor of the human antibody response. It blocks the activation of B cells by inhibiting the activation of T cells. 2-(2-(4-Methylpiperazin-1-yl)quinazolin-4-yl)acetamide also inhibits the production of cytokines, such as IL6 and IL10, which are important for B cell proliferation. This drug has been used as a research tool to study how B cells develop and function in various diseases such as AIDS, cancer, or autoimmune disorders.

Rabbit polyclonal GRIN2B antibody (Tyr1472)

A synthetic peptide for use as a blocking control in assays to test for specificity of RBMY1A1 antibody, catalog no. 70R-4807

A synthetic peptide for use as a blocking control in assays to test for specificity of ERCC4 antibody, catalog no. 70R-2117

Affinity purified Rat polyclonal CD104 antibody

A synthetic peptide for use as a blocking control in assays to test for specificity of KLHDC8A antibody, catalog no. 70R-4854

Zymostenol-d7 is a compound that is used in the synthesis of tamoxifen. It is also a multidrug resistance (MDR) inhibitor and is used as a cancer drug. Zymostenol-d7 inhibits the enzyme catalytic mechanism, which is required for cell division. This inhibition prevents the cell from dividing and growing uncontrollably, thereby preventing cancer growth. Zymostenol-d7 has been shown to exhibit anticancer activity by inhibiting the growth of tumor cells in vitro and in vivo.

Rat monoclonal CD45R antibody (FITC)

CA3 antibody was raised in Rabbit using Human CA3 as the immunogen

Lamin antibody was raised in mouse using Nuclear pore complex-lamina fraction of Xenopus laevis (XLKE-A6 cells) as the immunogen.

A synthetic peptide for use as a blocking control in assays to test for specificity of MITD1 antibody, catalog no. 70R-4506

Mouse monoclonal PCK 26 antibody

A synthetic peptide for use as a blocking control in assays to test for specificity of C12orf42 antibody, catalog no. 70R-4216

JP4-039 is a polymerase chain inhibitor that has been shown to have antimicrobial effects against bacteria. JP4-039 has been used as a model system for bowel disease and iron homeostasis in tissue culture. JP4-039 is also an effective and reactive proton donor, which can be used to treat ulceration, radiation injury, and other reactive conditions. JP4-039 is also known to inhibit ATP production by inhibiting the mitochondrial membrane potential.

Rabbit polyclonal PGBD3 antibody