Biochemicals and Reagents
Subcategories of "Biochemicals and Reagents"
- Biomolecules(98,560 products)
- By Biological Target(101,040 products)
- By Pharmacological Effects(6,954 products)
- Cryopreservatives(21 products)
- Desinfectants and Related Compounds(28 products)
- Hormones(531 products)
- Plant Biology(6,903 products)
- Secondary Metabolites(14,368 products)
Found 130639 products of "Biochemicals and Reagents"
Factor XIII Subunit A antibody
Factor XIII Subunit A antibody was raised in sheep using human Factor XIII Subunit A (A2) purified from plasma as the immunogen.Arsg Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of Arsg antibody, catalog no. 70R-9308Purity:Min. 95%Goat anti Human IgG (H + L) (biotin)
Goat anti-human IgG (H+L) (biotin) was raised in goat using human IgG whole molecule as the immunogen.Purity:Min. 95%GFAP antibody
The GFAP antibody is a highly specialized monoclonal antibody that targets glial fibrillary acidic protein (GFAP). This protein is primarily expressed in astrocytes, which are a type of glial cell found in the central nervous system. The GFAP antibody is widely used in life sciences research to study the activation and function of astrocytes.Alpha-1-microglobulin monoclonal antibody
Mouse anti-Human Alpha-1-microglobulin protein monoclonal antibodyFLAD1 antibody
FLAD1 antibody was raised using a synthetic peptide corresponding to a region with amino acids PGRSVTAGIIIVGDEILKGHTQDTNTFFLCRTLRSLGVQVCRVSVVPDEV
ApoBEC3F Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of APOBEC3F antibody, catalog no. 70R-4923Purity:Min. 95%RCV1 antibody
RCV1 antibody was raised in rabbit using the C terminal of RCV1 as the immunogen
Purity:Min. 95%CREG2 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of CREG2 antibody, catalog no. 70R-5475Purity:Min. 95%ODF4 antibody
ODF4 antibody was raised using the N terminal of ODF4 corresponding to a region with amino acids MDAEYSGNEFPRSEGERDQHQRPGKERKSGEAGWGTGELGQDGRLLSSTLPurity:Min. 95%TRMT6 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of TRMT6 antibody, catalog no. 70R-9439Purity:Min. 95%ANKRD7 antibody
ANKRD7 antibody was raised using the middle region of ANKRD7 corresponding to a region with amino acids EYEADLEAKNKDGYTPLLVAVINNNPKMVKFLLEKGADVNASDNYQRTALGiardia lamblia Antibody
The Giardia lamblia Antibody is a highly effective monoclonal antibody used in Life Sciences research. It is designed to specifically target and neutralize the growth factor of Giardia lamblia, a parasitic protozoan that causes gastrointestinal infections in humans. This antibody has been extensively tested and proven to be effective in inhibiting the growth and replication of Giardia lamblia. It works by binding to the target molecule on the surface of the parasite, preventing its interaction with host cells and disrupting its life cycle. Additionally, this antibody has shown potential as an antiviral agent due to its ability to inhibit protein kinases involved in viral replication. With its exceptional specificity and potency, the Giardia lamblia Antibody is an invaluable tool for researchers studying this pathogen and developing novel therapeutic approaches.ZNF619 antibody
ZNF619 antibody was raised in rabbit using the N terminal of ZNF619 as the immunogenPurity:Min. 95%Atp11c Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of Atp11c antibody, catalog no. 70R-8603Purity:Min. 95%Goat anti Mouse IgG (H + L) (Fab'2) (HRP)
Goat anti-mouse IgG (H+L) (Fab'2) (HRP) was raised in goat using murine IgG whole molecule as the immunogen.Purity:Min. 95%FGFR2 antibody
FGFR2 antibody is a monoclonal antibody that targets the fibroblast growth factor receptor 2 (FGFR2), a protein involved in cell signaling and growth. This antibody specifically binds to FGFR2 and inhibits its activity, preventing the activation of downstream signaling pathways. FGFR2 antibody has shown promising results in preclinical studies as a potential treatment for various diseases, including certain types of cancer. It can be used in research laboratories for studying the role of FGFR2 in cellular processes and as a tool for developing therapeutic strategies targeting this receptor. With its high specificity and efficacy, FGFR2 antibody is a valuable tool for researchers in the field of Life Sciences.SULT1C2 antibody
SULT1C2 antibody was raised using the C terminal of SULT1C2 corresponding to a region with amino acids LDQSISSFMRKGTVGDWKNHFTVAQNERFDEIYRRKMEGTSINFCMELLL-24-29 Heavy
A tryptic peptide consisting of residues 24-29 of the LL-37 peptide. The arginine residue at position 6 of this peptide is isotopically labelled with carbon-13 (6) and nitrogen-15 (4), giving this peptide a mass increase of 10 compared to the unlabelled peptide. This peptide can be used for quantification and optimisation in LC-MS/MS assays.LL-37 is a member of the large cationic family of anti-microbial peptides called cathelicidins which have broad-spectrum anti-microbial activity and are expressed in many species. The only cathelicidin found in humans is LL-37- this is produced in epithelial cells, by proteolytic cleavage from the C-terminal of the hCAP-18 protein. LL-37 can be processed into different forms of anti-microbial peptides. As well as its anti-microbial properties LL-37 also has anti-cancer properties and regulates many aspects of the innate immune system. Overexpression of LL-37 has been linked to autoimmune diseases such as asthma and psoriasis making LL-37 the most studied form of the human cathelicidin peptides.
Purity:Min. 95%Molecular weight:800.5 g/molKLHDC2 antibody
KLHDC2 antibody was raised using the N terminal of KLHDC2 corresponding to a region with amino acids VSDGRHMFVWGGYKSNQVRGLYDFYLPREELWIYNMETGRWKKINTEGDVFBXW11 antibody
FBXW11 antibody was raised using the N terminal of FBXW11 corresponding to a region with amino acids EPDSVIEDKTIELMNTSVMEDQNEDESPKKNTLWQISNGTSSVIVSRKRPCdc2 antibody
Cdc2 antibody was raised in Mouse using a purified recombinant fragment of Cdc2 expressed in E. coli as the immunogen.TRIM55 antibody
TRIM55 antibody was raised using the N terminal of TRIM55 corresponding to a region with amino acids SGGRFRCPSCRHEVVLDRHGVYGLQRNLLVENIIDIYKQESTRPEKKSDQKLHL32 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of KLHL32 antibody, catalog no. 70R-3205Purity:Min. 95%Fibronectin antibody
The Fibronectin antibody is a specific antibody used in Life Sciences research. It is a monoclonal antibody that specifically targets fibronectin, a protein involved in cell adhesion and migration. This antibody can be used for various applications, such as immunohistochemistry, Western blotting, and flow cytometry. The Fibronectin antibody has been extensively validated and is highly specific, ensuring accurate and reliable results in your experiments. It is supplied in a buffered solution for easy handling and storage. Whether you are studying cell signaling pathways, growth factors, or collagen deposition, the Fibronectin antibody is an essential tool for your research. Trust this high-quality antibody to provide accurate and reproducible results in your immunoassays.
SRFBP1 antibody
SRFBP1 antibody was raised in rabbit using the middle region of SRFBP1 as the immunogenPurity:Min. 95%IL9 antibody
The IL9 antibody is a polyclonal antibody used in Life Sciences research. It specifically binds to IL9, a cytokine that plays a crucial role in immune response and allergic reactions. The IL9 antibody can be used for various applications, including immunohistochemistry, Western blotting, and ELISA assays. It has been shown to neutralize the activity of IL9 by blocking its binding to its receptor. This antibody can be used to study the function of IL9 in different biological processes and may have potential therapeutic applications in diseases involving abnormal IL9 signaling.SHC1 antibody
The SHC1 antibody is a monoclonal antibody used in Life Sciences research. It specifically targets and binds to the SHC1 protein, which plays a crucial role in cellular signaling pathways. This antibody can be used to study the function of SHC1 and its involvement in various biological processes.SLC10A1 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of SLC10A1 antibody, catalog no. 70R-7046
Purity:Min. 95%Leptin antibody
Leptin antibody was raised in rabbit using highly pure recombinant human leptin as the immunogen.Purity:Min. 95%Raf1 antibody
The Raf1 antibody is a cytotoxic monoclonal antibody that targets the Raf1 protein, a key component of the MAPK signaling pathway. This antibody specifically binds to tyrosine-phosphorylated Raf1 and inhibits its activity, leading to the suppression of downstream signaling events. The Raf1 antibody has been extensively used in research studies to investigate the role of Raf1 in various cellular processes, such as cell proliferation, differentiation, and survival. It is commonly used in techniques like immunohistochemistry and Western blotting to detect the expression and activation status of Raf1 in different tissues and cell types. Additionally, this antibody has been employed in drug development efforts to test the efficacy of Raf1 inhibitors as potential cancer therapeutics. Its high specificity and sensitivity make it an invaluable tool for scientists working in the field of Life Sciences who aim to understand the complex mechanisms underlying cellular function and disease progression.RAB27A protein (His tag)
1-221 amino acids: MGSSHHHHHH SSGLVPRGSH MSDGDYDYLI KFLALGDSGV GKTSVLYQYT DGKFNSKFIT TVGIDFREKR VVYRASGPDG ATGRGQRIHL QLWDTAGQER FRSLTTAFFR DAMGFLLLFD LTNEQSFLNV RNWISQLQMH AYCENPDIVL CGNKSDLEDQ RVVKEEEAIA LAEKYGIPYF ETSAANGTNI SQAIEMLLDL IMKRMERCVD KSWIPEGVVR SNGHASTDQL SEEKEKGACG C
Purity:Min. 95%SLC22A7 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of SLC22A7 antibody, catalog no. 70R-7526Purity:Min. 95%DGKA antibody
The DGKA antibody is a specific antibody that targets the epidermal growth factor (EGF) and has applications in Life Sciences. It is a monoclonal antibody that can neutralize the effects of TNF-α, which is involved in inflammation and immune response. The DGKA antibody has been shown to inhibit the activity of collagen, TGF-beta, and other EGF-like proteins, which play key roles in cell growth and tissue repair. Additionally, it can bind to fibronectin and block its interactions with other molecules. This antibody is highly effective in blocking the activity of autoantibodies and growth factors, making it a valuable tool for research in various fields such as immunology, oncology, and regenerative medicine. With its ability to target activated chemokines, the DGKA antibody holds great potential for therapeutic applications as well.
