Biochemicals and Reagents
Subcategories of "Biochemicals and Reagents"
- Biomolecules(98,563 products)
- By Biological Target(101,038 products)
- By Pharmacological Effects(6,954 products)
- Cryopreservatives(21 products)
- Desinfectants and Related Compounds(28 products)
- Hormones(531 products)
- Plant Biology(6,903 products)
- Secondary Metabolites(14,368 products)
Found 130636 products of "Biochemicals and Reagents"
ZNF714 antibody
ZNF714 antibody was raised in rabbit using the N terminal of ZNF714 as the immunogenPurity:Min. 95%ECHS1 antibody
ECHS1 antibody was raised using the N terminal of ECHS1 corresponding to a region with amino acids IIAEKRGKNNTVGLIQLNRPKALNALCDGLIDELNQALKTFEEDPAVGAI
CD55 antibody
The CD55 antibody is a glycopeptide that acts as a neuroprotective agent in the field of Life Sciences. It is a glycoprotein with specific glycan structures that play a crucial role in its function. This antibody is available in both monoclonal and polyclonal forms, providing researchers with options for their experiments.CNDP2 antibody
CNDP2 antibody was raised in rabbit using the middle region of CNDP2 as the immunogenPurity:Min. 95%Caldesmon antibody
Caldesmon antibody is a highly specific monoclonal antibody that targets caldesmon, a protein involved in smooth muscle contraction. This antibody has been widely used in various applications within the Life Sciences field. It can be used for research purposes, such as studying the expression and localization of caldesmon in different tissues and cell types. Additionally, this monoclonal antibody has neutralizing properties and can inhibit the activity of caldesmon, making it a valuable tool for investigating the functional role of this protein.PYGL protein
PYGL protein is an epidermal growth factor-like protein that plays a crucial role in various biological processes. It has been extensively studied in the field of Life Sciences due to its unique characteristics and functions. PYGL protein exhibits neutralizing properties, which means it can counteract the effects of certain growth factors, such as TGF-beta.
Purity:Min. 95%MRPS2 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of MRPS2 antibody, catalog no. 70R-9443
Purity:Min. 95%FBXO25 antibody
FBXO25 antibody was raised using the N terminal of FBXO25 corresponding to a region with amino acids LGEAFNRLDFSSAIQDIRRFNYVVKLLQLIAKSQLTSLSGVAQKNYFNIL
C3ORF10 antibody
C3ORF10 antibody was raised using the middle region of C3Orf10 corresponding to a region with amino acids YIEIITSSIKKIADFLNSFDMSCRSRLATLNEKLTALERRIEYIEARVTKCENTG1 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of PPM1K antibody, catalog no. 70R-2456Purity:Min. 95%SLC4A5 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of SLC4A5 antibody, catalog no. 70R-6438Purity:Min. 95%SIGLEC10 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of SIGLEC10 antibody, catalog no. 70R-6154Purity:Min. 95%Gal3st4 antibody
Gal3st4 antibody was raised in rabbit using the C terminal of Gal3st4 as the immunogenPurity:Min. 95%GLMN Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of GLMN antibody, catalog no. 70R-5818Purity:Min. 95%CCR7 antibody
CCR7 antibody was raised in goat using a synthetic peptide DPGKPRKNVLVVALLVIFQVC corresponding to amino acid residues 2-22 of mouse CCR7 as the immunogen.Purity:Min. 95%ADH1B antibody
ADH1B antibody was raised using a synthetic peptide corresponding to a region with amino acids STAGKVIKCKAAVLWEVKKPFSIEDVEVAPPKAYEVRIKMVAVGICHTDDAnnexin A2 antibody
The Annexin A2 antibody is a highly specific monoclonal antibody that targets the human protein Annexin A2. This antibody is designed to recognize and bind to Annexin A2, which plays a crucial role in various cellular processes.Tel antibody
Tel antibody is a polyclonal antibody that targets the telomerase enzyme, which plays a crucial role in cell division and aging. This antibody specifically binds to the catalytic subunit of telomerase, inhibiting its activity and preventing further cell proliferation. Tel antibody has been extensively used in life sciences research to study telomere biology and its implications in various diseases, including cancer.
NMDAR2B antibody
The NMDAR2B antibody is a highly specialized antibody that targets the N-methyl-D-aspartate receptor subunit 2B (NMDAR2B). This antibody is commonly used in research and diagnostic applications to study the role of NMDAR2B in various biological processes. It has been extensively tested and validated for its specificity and sensitivity.Purity:Min. 95%TRIM55 antibody
TRIM55 antibody was raised using the N terminal of TRIM55 corresponding to a region with amino acids SGGRFRCPSCRHEVVLDRHGVYGLQRNLLVENIIDIYKQESTRPEKKSDQ
CSFR antibody
The CSFR antibody is a monoclonal antibody that specifically targets colony-stimulating factor receptors (CSFRs). These receptors play a crucial role in the regulation of immune cell production and activation. By binding to CSFRs, this antibody inhibits the activation of protein kinases and phosphatases, which are essential for the growth and survival of immune cells.C20ORF10 antibody
C20ORF10 antibody was raised using the N terminal Of C20Orf10 corresponding to a region with amino acids RLRTVLKNLSLLKLLKSSNRRIQELHKLAKRCWHSLLSVPKILRISSGEN
Purity:Min. 95%TIM antibody
The TIM antibody is a highly specialized monoclonal antibody that is used for ultrasensitive detection of various growth factors. It has been extensively studied and proven to be effective in detecting the presence of growth factors such as epidermal growth factor (EGF) in human serum and collagen samples. The TIM antibody utilizes electrochemical impedance spectroscopy, a cutting-edge technique that allows for precise and accurate measurements.
