Biochemicals and Reagents
Biochemicals and reagents are fundamental substances for research and development in fields such as biotechnology, molecular biology, pharmacology, and medicine. These products are essential for a variety of applications, including compound synthesis, biological sample analysis, metabolic process research, and drug production. At CymitQuimica, we offer a wide selection of high-quality, high-purity biochemicals and reagents suitable for various scientific and industrial needs. Our catalog includes enzymes, antibodies, nucleic acids, amino acids, and many other products, all designed to support researchers and professionals in their research and development projects, ensuring reliable and reproducible results.
Subcategories of "Biochemicals and Reagents"
- Biomolecules(98,563 products)
- By Biological Target(101,038 products)
- By Pharmacological Effects(6,954 products)
- Cryopreservatives(21 products)
- Desinfectants and Related Compounds(28 products)
- Hormones(531 products)
- Plant Biology(6,903 products)
- Secondary Metabolites(14,368 products)
Found 130636 products of "Biochemicals and Reagents"
Sort by
Purity (%)
0
100
|
0
|
50
|
90
|
95
|
100
C11ORF53 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of C11orf53 antibody, catalog no. 70R-3724
Purity:Min. 95%PSA antibody
PSA antibody is a monoclonal antibody that specifically targets prostate-specific antigen (PSA) in human serum. It is widely used in Life Sciences research and diagnostics, particularly in the field of prostate cancer. This antibody recognizes and binds to PSA, a glycoprotein that is produced by the prostate gland. The binding of the PSA antibody to PSA can be used for various applications, including immunoassays, immunohistochemistry, and western blotting. Additionally, this antibody has been modified with fatty acid or other acid modifications to improve its stability and performance. The PSA antibody can be immobilized on surfaces such as electrodes or cellulose for use in biosensors or diagnostic devices. It has also shown potential therapeutic effects, as it can interfere with the growth factor signaling pathways associated with prostate cancer progression.NOX1 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of NOX1 antibody, catalog no. 70R-7398Purity:Min. 95%PKC zeta antibody
The PKC zeta antibody is a highly specialized monoclonal antibody that is used for ultrasensitive detection in various immunoassays. It specifically targets and binds to protein kinase C zeta (PKCζ), an enzyme involved in signal transduction pathways. This antibody has been extensively validated and proven to provide accurate and reliable results in research and diagnostic applications.Purity:Min. 95%ATXN7L2 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of ATXN7L2 antibody, catalog no. 70R-4184Purity:Min. 95%SENP1 antibody
SENP1 antibody was raised using the middle region of SENP1 corresponding to a region with amino acids PQQMNGSDCGMFACKYADCITKDRPINFTQQHMPYFRKRMVWEILHRKLLPRDX1 antibody
The PRDX1 antibody is a nuclear antibody that is commonly used in the field of Life Sciences. It plays a crucial role in various biological processes, including collagen synthesis and electrode regulation. This antibody has been shown to have neutralizing effects on alpha-fetoprotein, making it an important tool in cancer research. Additionally, the PRDX1 antibody has been used as a monoclonal antibody for anti-mesothelin therapy and as an antiviral agent. It also acts as an inhibitor for certain growth factors in human serum. With its wide range of applications, the PRDX1 antibody is a valuable tool for researchers in various fields.Factor XIII B Polypeptide Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of F13B antibody, catalog no. 70R-5446Purity:Min. 95%SLC35C1 antibody
SLC35C1 antibody was raised using the N terminal of SLC35C1 corresponding to a region with amino acids TSISMVFLNKYLLDSPSLRLDTPIFVTFYQCLVTTLLCKGLSALAACCPGPARP6 antibody
PARP6 antibody was raised using a synthetic peptide corresponding to a region with amino acids HINISFLDEEVSTAWKVLRTEPIVLRLRFSLSQYLDGPEPSIEVFQPSNKTTC12 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of TTC12 antibody, catalog no. 70R-3356Purity:Min. 95%RPS14 antibody
The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the class of rifamycins. It is known to effectively treat tuberculosis infections by targeting and inhibiting bacterial growth. This active compound works by binding to DNA-dependent RNA polymerase, preventing transcription and replication within bacteria. In addition, it has been extensively studied using advanced techniques such as patch-clamp, which have confirmed its high efficacy in human erythrocytes. The drug undergoes various metabolic transformations, including hydrolysis, oxidation, reduction, and conjugation with glucuronic acid. Moreover, it specifically targets markers expressed in Mycobacterium tuberculosis strains and inhibits their growth. With its bactericidal activity and proven effectiveness, the 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a reliable choice for combating tuberculosis infections.IL11 antibody
IL11 antibody was raised in rabbit using highly pure recombinant hIL-11 as the immunogen.CD298 antibody
The CD298 antibody is a highly specific monoclonal antibody that targets DNA-binding proteins. It is widely used in the field of Life Sciences for various applications, including research and diagnostics. This antibody binds specifically to the surface glycoprotein CD298, forming a specific complex that can be detected using techniques such as electrochemical impedance spectroscopy. The CD298 antibody has been shown to have high affinity and specificity for its target, making it a valuable tool for studying the function and localization of DNA-binding proteins in various biological systems. Additionally, this antibody has been used in studies investigating the role of CD298 in processes such as glutamate signaling and proteolytic activity. With its versatility and reliability, the CD298 antibody is an essential tool for researchers working in the field of DNA-binding proteins.
Purity:Min. 95%IRS1 antibody
The IRS1 antibody is a highly specialized antibody used in the field of Life Sciences. It acts as a neutralizing agent against cholinergic activity, specifically targeting the β-catenin pathway. This antibody is designed to bind to and inhibit the function of IRS1, a human protein involved in insulin signaling. By blocking IRS1, this antibody disrupts downstream signaling pathways and prevents the activation of key enzymes such as acetyltransferase.ZP2 antibody
ZP2 antibody was raised using a synthetic peptide corresponding to a region with amino acids PDSFPQWNVVVDGCAYDLDNYQTTFHPVGSSVTHPDHYQRFDMKAFAFVSC14ORF172 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of C14orf172 antibody, catalog no. 70R-2828Purity:Min. 95%Glycogen Synthase antibody
The Glycogen Synthase antibody is a versatile tool used in various research applications. It plays a crucial role in the regulation of glycogen synthesis, making it an essential factor in understanding metabolic processes and diseases related to glucose metabolism.eIF4B antibody
The eIF4B antibody is a highly specialized product used in the field of Life Sciences. It is a polyclonal antibody that specifically targets and binds to eIF4B, a protein involved in the regulation of protein synthesis. This antibody has been extensively tested and validated for its specificity and sensitivity.MIP1 gamma protein (Mouse)
Region of MIP1 gamma protein corresponding to amino acids QITHATETKE VQSSLKAQQG LEIEMFHMGF QDSSDCCLSY NSRIQCSRFI GYFPTSGGCT RPGIIFISKR GFQVCANPSD RRVQRCIERL EQNSQPRTYK Q.Purity:Min. 95%LRRC8E Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of LRRC8E antibody, catalog no. 70R-6993Purity:Min. 95%TXNIP Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of TXNIP antibody, catalog no. 70R-9661Purity:Min. 95%Donkey anti Sheep IgG (H + L) (Texas Red)
Donkey anti-sheep IgG (H+L) was raised in donkey using sheep IgG whole molecule as the immunogen.Purity:Min. 95%Goat anti Human IgG (HRP)
Goat anti-human IgG (HRP) was raised in goat using human IgG F(ab')2 fragment as the immunogen.Purity:Min. 95%GATA1 antibody
The GATA1 antibody is a protein inhibitor that specifically targets the GATA1 element-binding protein. It plays a crucial role in regulating gene expression and cell differentiation in various biological processes. The GATA1 antibody can be used in Life Sciences research to study the function and interactions of GATA1 with other proteins, nucleotides, and elements. It is also being explored for its potential therapeutic applications, such as targeted drug delivery using nanoparticles conjugated with the GATA1 antibody. By inhibiting the activity of GATA1, this antibody offers a promising avenue for developing novel treatments in various fields of medicine.
HS-10296
CAS:HS-10296 is a novel pharmaceutical compound that functions as a specific inhibitor of EGFR (epidermal growth factor receptor), which is a key therapeutic target in certain cancer pathways. This compound is derived from a synthetic source, meticulously designed to target and interrupt the signaling pathways involved in tumor proliferation and survival. The mode of action of HS-10296 involves the competitive inhibition of the ATP-binding domain of EGFR tyrosine kinase, thereby preventing phosphorylation and subsequent activation of downstream signaling proteins involved in cell division and survival.Formula:C30H35N7O2Purity:Min. 95%Molecular weight:525.64 g/mol
