Biochemicals and Reagents
Subcategories of "Biochemicals and Reagents"
- Biomolecules(98,560 products)
- By Biological Target(101,036 products)
- By Pharmacological Effects(6,953 products)
- Cryopreservatives(21 products)
- Desinfectants and Related Compounds(28 products)
- Hormones(531 products)
- Plant Biology(6,903 products)
- Secondary Metabolites(14,369 products)
Found 130609 products of "Biochemicals and Reagents"
SETD4 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of SETD4 antibody, catalog no. 70R-8041Purity:Min. 95%KCNA7 antibody
KCNA7 antibody was raised using the C terminal of KCNA7 corresponding to a region with amino acids GEEAGMFSHVDMQPCGPLEGKANGGLVDGEVPELPPPLWAPPGKHLVTEVAIM2 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of AIM2 antibody, catalog no. 70R-8915Purity:Min. 95%PSMD3 antibody
PSMD3 antibody was raised in rabbit using the middle region of PSMD3 as the immunogenPurity:Min. 95%Nanog antibody
The Nanog antibody is a highly specific and potent tool used in Life Sciences research. It plays a crucial role as a growth factor and is involved in the regulation of pluripotency and self-renewal in embryonic stem cells. This antibody is widely used to study the activation products of Nanog, which are key protein biomarkers for various cellular processes.Purity:Min. 95%HNRNPR Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of HNRNPR antibody, catalog no. 70R-4656Purity:Min. 95%Pannexin 2 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of PANX2 antibody, catalog no. 70R-1761Purity:Min. 95%PF4 protein (Mouse)
Region of PF4 protein corresponding to amino acids VTSAGPEESD GDLSCVCVKT ISSGIHLKHI TSLEVIKAGR HCAVPQLIAT LKNGRKICLD RQAPLYKKVI KKILES.Purity:Min. 95%ATG2A antibody
ATG2A antibody was raised using a synthetic peptide corresponding to a region with amino acids PRRGPAPGAADSQSWASCMTTSLQLAQECLRDGLPEPSEPPQPLEGLEMFC9ORF68 antibody
C9ORF68 antibody was raised using the middle region of C9Orf68 corresponding to a region with amino acids CLDSSQFGKSSSSKQGDADFHGKASFATYQHSTSPGPLDQPLLRERFHPGRSU1 antibody
RSU1 antibody was raised using the C terminal of RSU1 corresponding to a region with amino acids PIADQFQLGVSHVFEYIRSETYKYLYGRHMQANPEPPKKNNDKSKKISRKAnnexin A1 antibody
Annexin A1 antibody was raised using the N terminal of ANXA1 corresponding to a region with amino acids WFIENEEQEYVQTVKSSKGGPGSAVSPYPTFNPSSDVAALHKAIMVKGVDZNF259 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of ZNF259 antibody, catalog no. 70R-8256
Purity:Min. 95%GABRG3 antibody
GABRG3 antibody was raised in rabbit using the N terminal of GABRG3 as the immunogen
Purity:Min. 95%PEG10 antibody
PEG10 antibody was raised in Mouse using a purified recombinant fragment of PEG10(aa1-120) expressed in E. coli as the immunogen.GluR1 antibody
The GluR1 antibody is an activated antibody that targets glutamate receptors in the brain. It has been shown to inhibit the activity of insulin and butyrylcholinesterase, which are enzymes involved in glucose metabolism and neurotransmitter regulation. This antibody can be used in various research applications, such as immunohistochemistry and Western blotting, to study the expression and localization of GluR1 receptors. Additionally, it can be used in life sciences research to investigate the role of GluR1 receptors in neuronal signaling pathways and synaptic plasticity. The GluR1 antibody is available as both polyclonal and monoclonal antibodies, providing researchers with options for their specific experimental needs.
EPCR protein
The EPCR protein is a recombinant protein that falls under the category of Recombinant Proteins & Antigens. It is widely used in the field of Life Sciences for various research purposes. This protein plays a crucial role in several biological processes and has been extensively studied in different contexts.
Purity:Min. 95%Tau antibody
The Tau antibody is a powerful tool in the field of Life Sciences. It is an antibody that specifically targets and binds to the glucose transporter known as Tau. This antibody has been extensively studied and has shown great potential in various research applications.
Purity:Min. 95%ENTPD7 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of ENTPD7 antibody, catalog no. 70R-6301Purity:Min. 95%GRHL2 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of GRHL2 antibody, catalog no. 70R-8379
Purity:Min. 95%ADCY6 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of ADCY6 antibody, catalog no. 70R-5955Purity:Min. 95%MRPL28 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of MRPL28 antibody, catalog no. 70R-2418NKIRAS2 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of NKIRAS2 antibody, catalog no. 70R-5860Purity:Min. 95%Rabbit anti Mouse IgG1
Rabbit anti-mouse IgG1 was raised in rabbit using murine IgG1 heavy chain as the immunogen.Purity:Min. 95%EGFR antibody
The EGFR antibody is a highly specific antibody that targets the epidermal growth factor receptor (EGFR). It is used in life sciences research to study the activation and function of EGFR in various biological processes. The antibody can be used for applications such as immunohistochemistry, western blotting, and enzyme-linked immunosorbent assays (ELISA). It recognizes both the activated and non-activated forms of EGFR and has been validated for use in human serum samples. The EGFR antibody is available in both polyclonal and monoclonal formats, providing researchers with options to suit their experimental needs. With its high specificity and sensitivity, this antibody is a valuable tool for studying the role of EGFR in cell signaling pathways, growth factor interactions, and disease mechanisms.
Purity:Min. 95%RBM8A antibody
RBM8A antibody was raised using the N terminal of RBM8A corresponding to a region with amino acids LHEAGGEDFAMDEDGDESIHKLKEKAKKRKGRGFGSEEGSRARMREDYDSUBE2L6 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of UBE2L6 antibody, catalog no. 70R-2778Purity:Min. 95%Rabbit anti Sheep IgG (HRP)
Rabbit anti-sheep IgG (HRP) was raised in rabbit using sheep IgG F(c) fragment as the immunogen.Purity:Min. 95%Tropomodulin 2 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of TMOD2 antibody, catalog no. 70R-5239Purity:Min. 95%
