Biochemicals and Reagents
Subcategories of "Biochemicals and Reagents"
- Biomolecules(98,564 products)
- By Biological Target(101,024 products)
- By Pharmacological Effects(6,952 products)
- Cryopreservatives(21 products)
- Desinfectants and Related Compounds(28 products)
- Hormones(531 products)
- Plant Biology(6,903 products)
- Secondary Metabolites(14,369 products)
Found 130609 products of "Biochemicals and Reagents"
Ractopamine antibody
Ractopamine antibody is a highly stable liquid formulation that contains monoclonal antibodies. It is specifically designed to detect and bind to ractopamine, a β-agonist commonly used as a feed additive in livestock production. The antibodies in this formulation are produced by hybridoma cells, ensuring high specificity and sensitivity. Ractopamine antibody can be used in various applications, including chromatographic assays, immunoassays, and electrode-based detection methods. This product is widely used in the Life Sciences field for research purposes and can also be utilized in the development of diagnostic kits or medicaments targeting ractopamine residues. Its ability to selectively bind to ractopamine makes it an essential tool for detecting this compound in various samples, including animal tissues, urine, or feed. With its reliable performance and ease of use, Ractopamine antibody provides researchers with a valuable tool for accurate analysis and monitoring of ractopamine levels.Purity:Min. 95%CACNG4 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of CACNG4 antibody, catalog no. 70R-5189Purity:Min. 95%IFN beta antibody
The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the class of rifamycins. It is highly effective in treating tuberculosis infections, thanks to its bactericidal activity. By binding to DNA-dependent RNA polymerase, this drug inhibits bacterial growth by preventing transcription and replication. Its potency has been demonstrated through extensive testing using the patch-clamp technique on human erythrocytes. Metabolized through various transformations, such as hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid, 6-Fluoro-3-indoxyl-beta-D-galactopyranoside specifically targets markers expressed in Mycobacterium tuberculosis strains and inhibits their growth in culture.RASSF1A antibody
RASSF1A antibody was raised in mouse using recombinant human RASSF1A (1-340aa) purified from E. coli as the immunogen.EPO antibody
The EPO antibody is a powerful medicament that targets erythropoietin, a growth factor responsible for red blood cell production. This monoclonal antibody specifically binds to erythropoietin and inhibits its activity, making it an effective tool in various life sciences applications.beta Actin Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of ACTB antibody, catalog no. 70R-2519Purity:Min. 95%RGS20 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of RGS20 antibody, catalog no. 70R-1129Purity:Min. 95%DNP antibody
DNP antibody was raised in goat using Dinitrophenol (DNP) conjugate as the immunogen.Purity:Min. 95%MyoD antibody
The MyoD antibody is a monoclonal antibody that is widely used in Life Sciences research. It acts as a growth factor and has neutralizing properties, making it an essential tool for studying cellular processes and signaling pathways. This antibody can be used in various applications, including Western blotting, immunofluorescence, and immunohistochemistry.PROCR antibody
The PROCR antibody is a highly stable liquid formulation that contains active agents for various applications in the field of life sciences. This antibody is designed to specifically target and bind to the PROCR cell antigen, which plays a crucial role in pluripotent stem cell differentiation and development. The PROCR antibody can be used for applications such as polymerase chain reaction (PCR), cell lysis, and detection of PROCR expression levels. It is available in both polyclonal and monoclonal forms, providing researchers with options to suit their specific needs. With its high specificity and sensitivity, this antibody is an essential tool for studying PROCR-related processes and exploring potential therapeutic applications. Whether you are conducting research or developing diagnostic assays, the PROCR antibody offers reliable results and consistent performance.
MYH1 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of MYH1 antibody, catalog no. 70R-3929Purity:Min. 95%ANKRD9 antibody
ANKRD9 antibody was raised using the middle region of ANKRD9 corresponding to a region with amino acids RARVLDRRGCSRVEGGGTSLHVACELARPECLFLLLGHGASPGLRDGGGL
KRT15 antibody
KRT15 antibody was raised in Mouse using a purified recombinant fragment of KRT15 expressed in E. coli as the immunogen.SMN1 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of SMN1 antibody, catalog no. 70R-4672Purity:Min. 95%Dynamin 1 antibody
Dynamin 1 antibody was raised in Mouse using a purified recombinant fragment of human Dynamin-1 expressed in E. coli as the immunogen.
HER2 antibody
The HER2 antibody is a monoclonal antibody that specifically targets the human epidermal growth factor receptor 2 (HER2). It is designed to bind to HER2 and inhibit its activity, thereby preventing the growth and spread of cancer cells. This antibody has been extensively studied in the field of Life Sciences and has shown promising results in treating various types of cancer.GPR3 antibody
GPR3 antibody was raised in rabbit using a synthetic peptide conjugated to KLH as the immunogen.Purity:Min. 95%EMAP II antibody
EMAP II antibody was raised in goat using highly pure recombinant human EMAP-II as the immunogen.
Purity:Min. 95%Eras Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of Eras antibody, catalog no. 70R-9352Purity:Min. 95%Rabbit anti Rat IgG
Rabbit anti-rat IgG was raised in rabbit using rat IgG F(c) fragment as the immunogen.Purity:Min. 95%ORC4L antibody
ORC4L antibody was raised using a synthetic peptide corresponding to a region with amino acids VLEICLIIAMKHLNDIYEEEPFNFQMVYNEFQKFVQRKAHSVYNFEKPVVPurity:Min. 95%BTF3L3 antibody
BTF3L3 antibody was raised using the middle region of BTF3L3 corresponding to a region with amino acids CRSTDHEPGKLAKLQAQVRIGGKGTAHRKKKVFHRTATADDKKLQFSLKK
DMRTC2 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of DMRTC2 antibody, catalog no. 70R-8100
Purity:Min. 95%OAT antibody
OAT antibody was raised using a synthetic peptide corresponding to a region with amino acids VRGKGLLNAIVIKETKDWDAWKVCLRLRDNGLLAKPTHGDIIRFAPPLVILYVE1 antibody
LYVE1 antibody was raised in rabbit using recombinant mouse soluble Lyve-1 as the immunogen.molecular weight ~50 kDa HC and ~25 kDa LCEME1 antibody
EME1 antibody was raised using a synthetic peptide corresponding to a region with amino acids AYPSPQLLVQAYQQCFSDKERQNLLADIQVRRGEGVTSTSRRIGPELSRR
FBXL7 antibody
FBXL7 antibody was raised using the N terminal of FBXL7 corresponding to a region with amino acids IRLASRPQKEQASIDRLPDHSMVQIFSFLPTNQLCRCARVCRRWYNLAWD
