Biochemicals and Reagents

SLC1A4 antibody was raised using a synthetic peptide corresponding to a region with amino acids ATKKGEQELAEVKVEAIPNCKSEEETSPLVTHQNPAGPVASAPELESKES

Rabbit polyclonal CCL24 antibody (FITC)

The WDR45 antibody is a highly specialized monoclonal antibody that targets the growth hormone receptor. It specifically binds to tyrosine residues on the receptor, inhibiting its activity and preventing the binding of growth factors. This antibody has shown promising results in the field of Life Sciences, particularly in the treatment of autoimmune disorders and cancer.

Mouse monoclonal PDE4B antibody

The ARAF antibody is a growth factor that has been extensively studied in the field of Life Sciences. It is a monoclonal antibody that specifically targets ARAF, a protein involved in cell signaling pathways. This antibody has shown cytotoxic activity when used as a conjugate with anti-CD20 antibodies, making it a promising candidate for targeted therapy in certain types of cancer. The ARAF antibody has undergone rigorous glycosylation analysis to ensure its stability and efficacy in human serum. Additionally, it has been found to inhibit the activity of epidermal growth factor (EGF) and other EGF-like proteins, further highlighting its potential therapeutic applications. Whether you're looking for antibodies for research purposes or seeking inhibitors for specific targets, the ARAF antibody offers a valuable tool in the field of Life Sciences.

Kallikrein 2 Monoclonal Antibody (HRP)

The BRCA1 antibody is a biomolecule commonly used in the Life Sciences field. It is water-soluble and can be used as both a polyclonal and monoclonal antibody. This antibody specifically targets BRCA1, a protein involved in DNA repair and cell growth regulation. It is often used to study the expression levels and localization of BRCA1 in various tissues and cell types.

GUCA1A antibody was raised using a synthetic peptide corresponding to a region with amino acids LYEFRQFFGLKNLSPSASQYVEQMFETFDFNKDGYIDFMEYVAALSLVLK

NUP35 antibody was raised using the C terminal of NUP35 corresponding to a region with amino acids STPRISTMRPLATAYKASTSDYQVISDRQTPKKDESLVSKAMEYMFGW

ITK antibody was raised in Mouse using a purified recombinant fragment of ITK(aa2-110) expressed in E. coli as the immunogen.

The RPE antibody is a monoclonal antibody used in Life Sciences research. It specifically targets the interleukin-6 (IL-6) protein and is widely used in studies related to exocytosis and nuclear processes. This antibody is available in both monoclonal and polyclonal forms, allowing researchers to choose the best option for their specific needs.

The BTK antibody is a highly specialized polyclonal antibody used in the field of Life Sciences. It is primarily used to target and inhibit Bruton's tyrosine kinase (BTK), an enzyme that plays a crucial role in cell signaling pathways. The BTK antibody has been extensively studied for its ability to block the growth of hepatocytes and epidermal cells, making it a valuable tool in research and therapeutic applications.

Rabbit polyclonal CTNNB1 antibody (HRP)

The beta hCG antibody is a glycoprotein that is produced by a hybridoma cell strain. It is commonly used in Life Sciences research for various applications, including immunoassays and antigen-antibody reactions. This antibody specifically targets beta human chorionic gonadotropin (hCG), which is a hormone produced during pregnancy.

ACTB antibody was raised in mouse using recombinant Human Beta Actin

SULT1E1 antibody was raised using the middle region of SULT1E1 corresponding to a region with amino acids LMVAGHPNPGSFPEFVEKFMQGQVPYGSWYKHVKSWWEKGKSPRVLFLFY

Rabbit Polyclonal STAT4 antibody (Tyr693)

CYP7B1 antibody was raised in rabbit using the C terminal of CYP7B1 as the immunogen

Purified Rabbit polyclonal MRPS32 antibody

A synthetic peptide for use as a blocking control in assays to test for specificity of SLC46A3 antibody, catalog no. 70R-1855

Rabbit polyclonal NARG1 antibody

ATM Monoclonal Antibody (FITC)

The HSP27 antibody is a powerful tool for research and diagnostics. It is an antibody that specifically targets Heat Shock Protein 27 (HSP27), a protein involved in cellular stress response. This antibody can be used to measure the levels of HSP27 in various samples, such as human serum or granulosa cells.

Rabbit polyclonal RPS25 antibody

The alpha Synuclein antibody is a powerful biomolecule that acts as a family kinase inhibitor. It belongs to the class of monoclonal antibodies and is widely used in the field of Life Sciences. This antibody specifically targets alpha Synuclein, a protein associated with neurodegenerative diseases such as Parkinson's disease.

GAL3 antibody was raised in Rabbit using Human GAL3 as the immunogen

Purified native Human hCG alpha protein

Clostridum difficile toxin B antibody was raised in mouse using toxin B of Clostridium difficile as the immunogen.

A synthetic peptide for use as a blocking control in assays to test for specificity of SIRT5 antibody, catalog no. 70R-1009

Goat anti Rabbit IgG (H + L) (rhodamine) secondary antibody; FC 1:50-1:200; IF 1:1000-1:10000

A synthetic peptide for use as a blocking control in assays to test for specificity of GK antibody, catalog no. 70R-4533

The CDC25C antibody is a monoclonal antibody that specifically targets the CDC25C protein. This protein plays a crucial role in cell division and is involved in regulating the cell cycle. The CDC25C antibody has been shown to inhibit the activity of this protein, leading to cell cycle arrest and preventing further cell division.

The Tau antibody is a highly specialized antibody that targets and interacts with the protein Tau. This protein plays a crucial role in maintaining the stability and structure of microtubules in neurons. The Tau antibody can be used in various research applications, including immunohistochemistry, western blotting, and ELISA.

KCNJ4 antibody was raised using the middle region of KCNJ4 corresponding to a region with amino acids AVAAGLGLEAGSKEEAGIIRMLEFGSHLDLERMQASLPLDNISYRRESAI

MMEL1 antibody was raised using the middle region of MMEL1 corresponding to a region with amino acids EVVVYGIPYLQNLENIIDTYSARTIQNYLVWRLVLDRIGSLSQRFKDTRV

The Tyrosine Hydroxylase antibody is a powerful tool for researchers in the field of Life Sciences. This monoclonal antibody is specifically designed to neutralize the activity of Tyrosine Hydroxylase, an enzyme involved in the synthesis of neurotransmitters like dopamine and norepinephrine. By targeting and inhibiting Tyrosine Hydroxylase, this antibody allows researchers to study the role of this enzyme in various biological processes.

The MMP7 antibody is a highly specialized monoclonal antibody that targets matrix metalloproteinase 7 (MMP7), an enzyme involved in the breakdown of extracellular matrix components. This antibody is widely used in Life Sciences research to study various cellular processes, including cell migration, tissue remodeling, and cancer progression.

DNALI1 antibody was raised using the C terminal of DNALI1 corresponding to a region with amino acids ALQAEQGKSDMERKIAELETEKRDLERQVNEQKAKCEATEKRESERRQVE

Influenza A antibody (H1N1) (FITC) was raised in goat using Influenza A, strain USSR (H1N1) as the immunogen.

enhanced one component ready-to-use3,3',5,5'-tetramethylbenzidine substrate for ELISA

Armenian Hamster monoclonal IgG Isotype Control antibody (FITC)

Purified Rabbit polyclonal MYB28 antibody

CCNB1 antibody was raised in rabbit using the C terminal of CCNB1 as the immunogen