Biochemicals and Reagents
Subcategories of "Biochemicals and Reagents"
- Biomolecules(98,556 products)
- By Biological Target(100,865 products)
- By Pharmacological Effects(6,941 products)
- Cryopreservatives(21 products)
- Desinfectants and Related Compounds(28 products)
- Hormones(530 products)
- Plant Biology(6,904 products)
- Secondary Metabolites(14,368 products)
Found 130538 products of "Biochemicals and Reagents"
GAS7 protein (His tag)
1-416 amino acids: MGSSHHHHHH SSGLVPRGSH MKPGMVPPPP GEESQTVILP PGWQSYLSPQ GRRYYVNTTT NETTWERPSS SPGIPASPGS HRSSLPPTVN GYHASGTPAH PPETAHMSVR KSTGDSQNLG SSSPSKKQSK ENTITINCVT FPHPDTMPEQ QLLKPTEWSY CDYFWADKKD PQGNGTVAGF ELLLQKQLKG KQMQKEMSEF IRERIKIEED YAKNLAKLSQ NSLASQEEGS LGEAWAQVKK SLADEAEVHL KFSAKLHSEV EKPLMNFREN FKKDMKKCDH HIADLRKQLA SRYASVEKAR KALTERQRDL EMKTQQLEIK LSNKTEEDIK KARRKSTQAG DDLMRCVDLY NQAQSKWFEE MVTTTLELER LEVERVEMIR QHLCQYTQLR HETDMFNQST VEPVDQLLRK VDPAKDRELW VREHKTGNIR PVDMEIPurity:Min. 95%IGF-1R antibody
The IGF-1R antibody is a powerful tool in the field of Life Sciences. It is a polyclonal antibody that specifically targets the insulin-like growth factor-1 receptor (IGF-1R). This receptor plays a crucial role in cell growth and development, making it an important target for research and therapeutic applications.Purity:Min. 95%ANPEP Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of ANPEP antibody, catalog no. 70R-10232Purity:Min. 95%ACDC Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of ACDC antibody, catalog no. 70R-1712Purity:Min. 95%CD14 antibody
The CD14 antibody is a monoclonal antibody used in Life Sciences research. It is known for its cell proliferation inhibitory properties and its ability to target tumor necrosis factor-alpha (TNF-α). The CD14 antibody can be used in various applications, including electrode hybridization, cytotoxic assays, chromatographic techniques, and cell lysis. Additionally, this antibody has been found to have neuroprotective effects and can inhibit the activity of hydrogen fluoride. The CD14 antibody is also commonly used in the development of therapeutic strategies targeting specific antigens, such as the anti-CD33 antibody. With its wide range of applications and effectiveness, the CD14 antibody is a valuable tool for researchers in the field of Life Sciences.MMP16 antibody
The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the category of rifamycins. It is specifically designed to combat tuberculosis infections and contains active compounds that exhibit bactericidal activity. Through its unique mechanism of action, it inhibits bacterial growth by binding to DNA-dependent RNA polymerase, preventing transcription and replication. This drug has been extensively studied using advanced techniques like the patch-clamp technique on human erythrocytes, demonstrating its high potency in human subjects.Purity:Min. 95%ACP5 protein
The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the class of rifamycins. It is known to be highly effective in treating tuberculosis infections. This active compound exhibits bactericidal activity by binding to DNA-dependent RNA polymerase, thereby hindering transcription and replication. Extensive research has been conducted on human erythrocytes using a patch-clamp technique, demonstrating its high efficacy. The drug undergoes various metabolic transformations, including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, it specifically targets markers expressed at high levels in Mycobacterium tuberculosis strains and inhibits their growth in culture.Purity:Min. 95%HIBADH antibody
HIBADH antibody was raised using the middle region of HIBADH corresponding to a region with amino acids AKEVEKMGAVFMDAPVSGGVGAARSGNLTFMVGGVEDEFAAAQELLGCMGUSP7 antibody
The USP7 antibody is a histidine-rich monoclonal antibody that is used in the field of Life Sciences. It specifically targets and binds to USP7, a protein involved in various cellular processes such as dopamine and steroid metabolism, glycosylation, and activation of phosphatase. This antibody has been extensively studied for its role in growth factor signaling pathways and has shown promising results in inhibiting the growth of certain cancer cells. Additionally, the USP7 antibody has been used to detect autoantibodies and study their association with diseases such as autoimmune disorders and hepatocyte growth. Its unique fatty acid isothiocyanate conjugation allows for efficient labeling and detection in experimental settings. With its specificity and versatility, the USP7 antibody is an invaluable tool for researchers in the field of Life Sciences.Tjp1 antibody
Tjp1 antibody was raised in rabbit using the N terminal of Tjp1 as the immunogenPurity:Min. 95%POLR1B antibody
POLR1B antibody was raised using a synthetic peptide corresponding to a region with amino acids SDKFQVRTTGARDRVTNQPIGGRNVQGGIRFGEMERDALLAHGTSFLLHDPPIB Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of PPIB antibody, catalog no. 70R-7220Purity:Min. 95%CTNNB1 antibody
The CTNNB1 antibody is a high-specificity, monoclonal antibody that is widely used in the field of life sciences. It is known for its antiviral properties and its ability to target CTNNB1, a protein involved in various cellular processes. This antibody has a low density and can effectively bind to collagen and glycan structures. It can also be used in the detection of alpha-fetoprotein and interferon.ADAM19 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of ADAM19 antibody, catalog no. 70R-7216
Purity:Min. 95%Vitronectin antibody
The Vitronectin antibody is a monoclonal antibody used in the field of Life Sciences. It is derived from murine monoclonal antibodies and is specifically designed to target and bind to vitronectin, a glycoprotein involved in various biological processes. This antibody has been extensively characterized and validated for its high specificity and affinity towards vitronectin.KLF4 antibody
KLF4 antibody was raised in Mouse using a purified recombinant fragment of human KLF4 expressed in E. coli as the immunogen.SLC37A4 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of SLC37A4 antibody, catalog no. 70R-6294Purity:Min. 95%Gnpda1 antibody
Gnpda1 antibody was raised in rabbit using the N terminal of Gnpda1 as the immunogen
Purity:Min. 95%TFPI antibody
TFPI antibody is an effective tool for studying thrombotic microangiopathy. It specifically targets actin filaments, which play a crucial role in the development of this condition. This drug antibody can be used in both polyclonal and monoclonal forms, making it versatile for various research applications in life sciences. TFPI antibody is particularly useful in investigating atypical hemolytic conditions and can provide valuable insights into their underlying mechanisms. Researchers can utilize this antibody to determine the optimal dosage and efficacy of inhibitors or other therapeutic interventions. Additionally, TFPI antibody is compatible with histidine staining and phalloidin labeling techniques, enabling precise visualization of actin structures. Its binding specificity makes it an essential tool for studying glucose transporter regulation and other related processes.
Vimentin antibody
The Vimentin antibody is a highly effective tool for research in the field of Life Sciences. It is a monoclonal antibody that specifically targets vimentin, a type III intermediate filament protein found in various cell types. Vimentin plays a crucial role in maintaining cell structure and integrity, and it is involved in processes such as cell migration, adhesion, and signaling.
BBS5 antibody
BBS5 antibody was raised in rabbit using the N terminal of BBS5 as the immunogenPurity:Min. 95%GLP1 antibody
The GLP1 antibody is a neutralizing antibody used in Life Sciences research. It has an inhibitory effect on protein kinase activity and chemokine signaling, making it a valuable tool for studying these processes. The GLP1 antibody specifically targets glucagon-like peptide 1 (GLP-1), a hormone involved in glucose homeostasis. This antibody can be used in various applications, including the development of inhibitors and therapeutic antibodies. It is commonly used as a control antibody in experiments to ensure accurate and reliable results. The GLP1 antibody is available as a monoclonal antibody and can be conjugated with different polymers for specific detection purposes. With its high specificity and potency, the GLP1 antibody is an essential tool for researchers in the field of Life Sciences.STAT3 antibody
The STAT3 antibody is a peptide antigen used in Life Sciences research. It is commonly used in studies involving the expression plasmid and antibodies. This antibody specifically targets the inhibitory factor of the cytokine family, interleukin-6, and has been shown to inhibit the activation of reactive glial fibrillary acidic cells. The STAT3 antibody can be used in various experimental techniques, such as immunohistochemistry and Western blotting. Its high specificity and affinity make it an ideal tool for researchers studying cell signaling pathways and inflammatory responses. With its wide range of applications, this polyclonal antibody is a valuable asset for any laboratory or research facility.
APOL2 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of APOL2 antibody, catalog no. 70R-8846
Purity:Min. 95%TMEFF2 antibody
The TMEFF2 antibody is a highly specialized monoclonal antibody that has neutralizing properties. It has been extensively studied for its ability to inhibit the activity of TMEFF2, a protein involved in various cellular processes. Through molecular docking studies, it has been determined that this antibody binds to TMEFF2 and prevents its interaction with other molecules, thereby immobilizing its function.CD4 antibody (FITC)
CD4 antibody (FITC) was raised in mouse using P815 cell transfected with human CD4 as the immunogen.MAGEA9 antibody
MAGEA9 antibody was raised in rabbit using the N terminal of MAGEA9 as the immunogenPurity:Min. 95%
