Biochemicals and Reagents
Biochemicals and reagents are fundamental substances for research and development in fields such as biotechnology, molecular biology, pharmacology, and medicine. These products are essential for a variety of applications, including compound synthesis, biological sample analysis, metabolic process research, and drug production. At CymitQuimica, we offer a wide selection of high-quality, high-purity biochemicals and reagents suitable for various scientific and industrial needs. Our catalog includes enzymes, antibodies, nucleic acids, amino acids, and many other products, all designed to support researchers and professionals in their research and development projects, ensuring reliable and reproducible results.
Subcategories of "Biochemicals and Reagents"
- Biomolecules(98,574 products)
- By Biological Target(100,726 products)
- By Pharmacological Effects(6,937 products)
- Cryopreservatives(21 products)
- Desinfectants and Related Compounds(28 products)
- Hormones(439 products)
- Plant Biology(6,907 products)
- Secondary Metabolites(14,367 products)
Found 130493 products of "Biochemicals and Reagents"
Sort by
Purity (%)
0
100
|
0
|
50
|
90
|
95
|
100
LOC728566 antibody
LOC728566 antibody was raised in rabbit using the N terminal of LOC728566 as the immunogen
Purity:Min. 95%KIAA0776 antibody
KIAA0776 antibody was raised using the middle region of KIAA0776 corresponding to a region with amino acids EYLIKPLNKTYLEVVRSVFMSSTTSASGTGRKRTIKDLQEEVSNLYNNIRFABP6 protein (isoform 2)
1-128 amino acids: MAFTGKFEME SEKNYDEFMK LLGISSDVIE KAHNFKIVTE VQQDGQDFTW SQHYYGGHTM TNKFTVGKES NIQTMGGKTF KATVQMEGGK LVVNFPNYHQ TSEIVGDKLV EVSTIGGVTY ERVSKRLAPurity:Min. 95%STS Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of STS antibody, catalog no. 70R-1914Purity:Min. 95%Rabbit anti Mouse Lambda Chain (rhodamine)
Rrabbit anti-mouse lambda chain (Rhodamine) was raised in rabbit using murine lambda light chain as the immunogen.
Purity:Min. 95%MASP2 antibody
The MASP2 antibody is a highly specialized monoclonal antibody used in immunoassays and research within the Life Sciences field. It is designed to specifically target and bind to the MASP2 protein, which plays a crucial role in the activation of the complement system.FITC antibody
The FITC antibody is a highly specialized product in the field of Life Sciences. It is an activated monoclonal antibody that is designed to neutralize specific targets. The FITC antibody has been extensively studied and optimized for use in various applications, including immunoassays, flow cytometry, and immunohistochemistry.Cytokeratin 7 antibody
Cytokeratin 7 antibody was raised in Mouse using a purified recombinant fragment of human CK7 expressed in E. coli as the immunogen.Plasminogen antibody
Plasminogen antibody was raised in goat using human plasminogen purified from plasma as the immunogen.Purity:Min. 95%ABL1 antibody
The ABL1 antibody is a powerful tool used in the field of Life Sciences for various applications. It is an antibody specifically designed to target and bind to the ABL1 protein, which plays a crucial role in cell signaling and regulation. This antibody can be used for research purposes, such as studying the function of ABL1 in different cellular processes or investigating its involvement in diseases like cancer.TNFRSF14 antibody
TNFRSF14 antibody was raised in rabbit using the middle region of TNFRSF14 as the immunogenPEA15 antibody
PEA15 antibody was raised in rabbit using the C terminal of PEA15 as the immunogenPurity:Min. 95%Cyb5r2 antibody
Cyb5r2 antibody was raised in rabbit using the C terminal of Cyb5r2 as the immunogenPurity:Min. 95%TRIM48 antibody
TRIM48 antibody was raised in rabbit using the C terminal of TRIM48 as the immunogenPurity:Min. 95%DSCAM Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of DSCAM antibody, catalog no. 70R-6114Purity:Min. 95%LOC390738 antibody
LOC390738 antibody was raised in rabbit using the middle region of LOC390738 as the immunogenPurity:Min. 95%GluR4 antibody
The GluR4 antibody is a highly specialized antibody used in Life Sciences research. It is commonly used in studies involving glutamate receptors and their role in various biological processes. This antibody specifically targets the GluR4 subunit, which is known to be involved in neuronal excitability and synaptic plasticity.CDH3 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of CDH3 antibody, catalog no. 70R-1708Purity:Min. 95%NEGR1 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of NEGR1 antibody, catalog no. 70R-9341Purity:Min. 95%ARID5A Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of ARID5A antibody, catalog no. 70R-9027Purity:Min. 95%Desmoglein 4 antibody
Desmoglein 4 antibody is an antiviral agent that is commonly used in Life Sciences research. It is a high-flux antibody that can be used for staining and detection purposes. This antibody specifically targets desmoglein 4, which is an extracellular antigen involved in cell adhesion. Desmoglein 4 antibody can be used as a serum marker to detect the presence of this antigen in various biological samples. It is available in both polyclonal and monoclonal forms, providing options for different experimental needs. This antibody has potential applications in chemotherapy, as well as in the study of interleukins and autoantibodies. With its versatility and specificity, desmoglein 4 antibody offers researchers a valuable tool for their investigations in the field of Life Sciences.LRRC20 antibody
LRRC20 antibody was raised using the middle region of LRRC20 corresponding to a region with amino acids TTFSQLRELHLEGNFLHRLPSEVSALQHLKAIDLSRNQFQDFPEQLTALPFTSJD1 antibody
FTSJD1 antibody was raised using the middle region of FTSJD1 corresponding to a region with amino acids LMYLLNCCFDQVHVFKPATSKAGNSEVYVVCLHYKGREAIHPLLSKMTLNPP2447 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of PP2447 antibody, catalog no. 70R-1269Purity:Min. 95%PLS3 antibody
The PLS3 antibody is a monoclonal antibody that targets the growth factor phospholipid scramblase (PLS3). It is used in Life Sciences research to study the role of PLS3 in various cellular processes. The antibody is produced using cellulose as a support material and has been shown to specifically bind to PLS3. It can be used in experiments involving human serum, as it does not react with serum albumin or other common serum proteins. The PLS3 antibody is also available as a polyclonal antibody for researchers who require larger quantities or need to target multiple epitopes.
NPTX1 antibody
The NPTX1 antibody is a highly specific polyclonal antibody that targets the NPTX1 protein. NPTX1 is an oncogene homolog and plays a crucial role in various biological processes, including cholinergic signaling and β-catenin activation. This antibody has been extensively validated in life sciences research and has shown high specificity and sensitivity in detecting NPTX1 expression.
