Biochemicals and Reagents
Biochemicals and reagents are fundamental substances for research and development in fields such as biotechnology, molecular biology, pharmacology, and medicine. These products are essential for a variety of applications, including compound synthesis, biological sample analysis, metabolic process research, and drug production. At CymitQuimica, we offer a wide selection of high-quality, high-purity biochemicals and reagents suitable for various scientific and industrial needs. Our catalog includes enzymes, antibodies, nucleic acids, amino acids, and many other products, all designed to support researchers and professionals in their research and development projects, ensuring reliable and reproducible results.
Subcategories of "Biochemicals and Reagents"
- Biomolecules(98,575 products)
- By Biological Target(100,710 products)
- By Pharmacological Effects(6,937 products)
- Cryopreservatives(21 products)
- Desinfectants and Related Compounds(28 products)
- Hormones(421 products)
- Plant Biology(6,907 products)
- Secondary Metabolites(14,367 products)
Found 130493 products of "Biochemicals and Reagents"
Sort by
Purity (%)
0
100
|
0
|
50
|
90
|
95
|
100
Annexin A7 antibody
Annexin A7 antibody was raised using the N terminal of ANXA7 corresponding to a region with amino acids GGQMPSQYPGGQPTYPSQPATVTQVTQGTIRPAANFDAIRDAEILRKAMKGPR161 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of GPR161 antibody, catalog no. 70R-1841Purity:Min. 95%GST Antibody
The GST Antibody is a highly specific and potent antibody that targets the cytosolic protein GST. It is designed to recognize and bind to the target molecule with high affinity, making it an ideal tool for various applications in Life Sciences research. The antibody is produced using advanced techniques, including DNA aptamer technology, resulting in a highly purified and effective product.KCNAB3 antibody
KCNAB3 antibody was raised using the N terminal of KCNAB3 corresponding to a region with amino acids RNLGKSGLRVSCLGLGTWVTFGSQISDETAEDVLTVAYEHGVNLFDTAEVNR2C2 antibody
NR2C2 antibody was raised using the C terminal of NR2C2 corresponding to a region with amino acids AQCAQVMSLSTILAAIVNHLQNSIQEDKLSGDRIKQVMEHIWKLQEFCNSEGFR antibody
The EGFR antibody is a highly effective polyclonal antibody that targets the epidermal growth factor receptor (EGFR). This antibody specifically binds to the influenza hemagglutinin and cardiac muscle troponin, making it an essential tool in life sciences research. The EGFR antibody has neutralizing and cytotoxic properties, making it ideal for studying cell signaling pathways and investigating diseases such as cancer. It has been extensively used in studies on mcf-7 cells and virus surface antigens. In addition to its research applications, this antibody is also used in clinical settings as a therapeutic agent. With its high specificity and potency, the EGFR antibody is an invaluable tool for researchers and clinicians alike.Purity:Min. 95%Chicken Liver Tissue Lysate
Freshly prepared tissue lysate isolated from liver of normal chicken
Purity:Min. 95%Loxl2 antibody
Loxl2 antibody was raised in rabbit using the C terminal of Loxl2 as the immunogenPurity:Min. 95%GALT Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of GALT antibody, catalog no. 70R-2643
Purity:Min. 95%BAG6 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of BAG6 antibody, catalog no. 70R-10346Purity:Min. 95%NTRK3 antibody
The NTRK3 antibody is a powerful tool in the field of Life Sciences. It targets the growth factor receptor, erythropoietin receptor, and inhibits the activity of chimeric proteins. This monoclonal antibody has been extensively studied for its anti-angiogenic properties and has shown promising results in inhibiting endothelial growth. Additionally, it acts as a cytotoxic agent against certain cancer cells by targeting specific protein kinases involved in cell proliferation. The NTRK3 antibody is commonly used in hybridization experiments and can be detected using specialized electrodes. With its potent anti-VEGF activity, this antibody holds great potential for therapeutic applications in various diseases related to angiogenesis. Researchers and scientists rely on the NTRK3 antibody to advance their understanding of complex biological processes and develop innovative treatments.FBXW11 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of FBXW11 antibody, catalog no. 70R-2812Purity:Min. 95%CHRNA7 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of CHRNA7 antibody, catalog no. 70R-1540Purity:Min. 95%Trehalase antibody
The Trehalase antibody is a monoclonal antibody with antiangiogenic properties. It specifically targets amyloid plaque and inhibits the growth factor TGF-beta, which is known to be involved in angiogenesis. This antibody has been shown to neutralize the activity of endothelial growth factors, preventing the formation of new blood vessels and thus inhibiting tumor growth. Additionally, it acts as a low-molecular-weight inhibitor, blocking the binding of EGF-like chemokines to their receptors. The Trehalase antibody has also demonstrated cytotoxic effects on cancer cells, making it a promising candidate for therapeutic applications in the field of Life Sciences.RGD1307041 antibody
RGD1307041 antibody was raised in rabbit using the middle region of RGD1307041 as the immunogen
Purity:Min. 95%C16orf73 antibody
C16orf73 antibody was raised using the middle region of C16orf73 corresponding to a region with amino acids CSLTGSVAEETLGCTFVLSHRARSGLKISVLSCKLADPTEASRNLSGQKHArpT2 antibody
Arp-T2 antibody was raised in Guinea Pig using synthetic middle domain of human Arp-T2 protein coupled to KLH as the immunogen.Purity:Min. 95%Rabbit anti Bovine IgG (Alk Phos)
Rabbit anti-bovine IgG (Alk Phos) was raised in rabbit using bovine IgG F(ab')2 fragment as the immunogen.Purity:Min. 95%SLC5A4 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of SLC5A4 antibody, catalog no. 70R-1794
Purity:Min. 95%GORASP2 antibody
GORASP2 antibody was raised in rabbit using the C terminal of GORASP2 as the immunogenRAB35 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of RAB35 antibody, catalog no. 70R-9158Purity:Min. 95%LAMB1 protein
The LAMB1 protein is a glycoprotein that plays a crucial role in cell adhesion and migration. It can be immobilized on an electrode for ultrasensitive detection using electrochemical impedance spectroscopy. This protein is also involved in neutralizing antibodies and can be used as a target for monoclonal antibody therapy. Recombinant forms of the LAMB1 protein are available for research purposes, including the study of glycation and its effects on protein function. Additionally, the LAMB1 protein has been investigated as a potential component of DNA vaccines and has shown promising results in preclinical studies. Its expression levels can be measured in various biological samples, including human serum and messenger RNA. For researchers in the life sciences field, the LAMB1 protein offers valuable insights into cellular processes and potential therapeutic applications.Purity:Min. 95%MTA3 antibody
MTA3 antibody was raised in rabbit using the C terminal of MTA3 as the immunogenPurity:Min. 95%EFNA4 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of EFNA4 antibody, catalog no. 70R-10341
Purity:Min. 95%MMP19 antibody
MMP19 antibody was raised using the C terminal of MMP19 corresponding to a region with amino acids IHFFKGDKVWRYINFKMSPGFPKKLNRVEPNLDAALYWPLNQKVFLFKGSKIAA0319 antibody
KIAA0319 antibody was raised using the N terminal of KIAA0319 corresponding to a region with amino acids EEMSEYSDDYRELEKDLLQPSGKQEPRGSAEYTDWGLLPGSEGAFNSSVGp21Cip1 antibody
The p21Cip1 antibody is a monoclonal antibody used in Life Sciences research. It specifically targets the p21Cip1 protein, which is a growth factor that plays a crucial role in cell cycle regulation. The antibody can be used in various applications such as Western blotting, immunofluorescence, and immunohistochemistry assays to detect and quantify the expression of p21Cip1.
CD10 antibody
CD10 antibody was raised in Mouse using a purified recombinant fragment of human CD-10 expressed in E. coli as the immunogen.Guinea Pig Serum Albumin antibody (biotin)
Rabbit polyclonal Guinea Pig Serum Albumin antibody (biotin)SLC25A25 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of SLC25A25 antibody, catalog no. 70R-6750Purity:Min. 95%SRR antibody
SRR antibody was raised using the middle region of SRR corresponding to a region with amino acids GVGVAAVLSQHFQTVSPEVKNICIVLSGGNVDLTSSITWVKQAERPASYQ
TECK protein
Region of TECK protein corresponding to amino acids QGVFEDCCLA YHYPIGWAVL RRAWTYRIQE VSGSCNLPAA IFYLPKRHRK VCGNPKSREV QRAMKLLDAR NKVFAKLHHN MQTFQAGPHA VKKLSSGNSK LSSSKFSNPI SSSKRNVSLL ISANSGL
Purity:Min. 95%AADAT Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of AADAT antibody, catalog no. 70R-2917Purity:Min. 95%BMP4 protein
Region of BMP4 protein corresponding to amino acids HHSQRARKKN KNCRRHSLYV DFSDVGWNDW IVAPPGYQAF YCHGDCPFPL ADHLNSTNHA IVQTLVNSVN SSIPKACCVP TELSAISMLY LDEYDKVVLK NYQEMVVEGC GCR.Purity:Min. 95%
