Biochemicals and Reagents
Subcategories of "Biochemicals and Reagents"
- Biomolecules(98,575 products)
- By Biological Target(100,710 products)
- By Pharmacological Effects(6,937 products)
- Cryopreservatives(21 products)
- Desinfectants and Related Compounds(28 products)
- Hormones(421 products)
- Plant Biology(6,907 products)
- Secondary Metabolites(14,367 products)
Found 130493 products of "Biochemicals and Reagents"
Factor XIII Subunit A antibody
Factor XIII Subunit A antibody was raised in sheep using human Factor XIII Subunit A (A2) purified from plasma as the immunogen.Purity:Min. 95%Human IgG Antibody
The Human IgG Antibody is a monoclonal antibody that plays a crucial role in various biological processes. It is widely used in Life Sciences research and immunoassays. This specific antibody targets various proteins, including growth factors, creatine, TGF-beta, epidermal growth factor, and the plasminogen receptor. By binding to these proteins, the Human IgG Antibody can modulate their activity and regulate important cellular functions.Ovarian Cancer Antigen (CA 125)
Please enquire for more information about Ovarian Cancer Antigen (CA 125) including the price, delivery time and more detailed product information at the technical inquiry form on this pageZNF579 antibody
ZNF579 antibody was raised in rabbit using the C terminal of ZNF579 as the immunogenPurity:Min. 95%HNMT antibody
HNMT antibody was raised in rabbit using the N terminal of HNMT as the immunogen
Purity:Min. 95%SLC5A8 antibody
SLC5A8 antibody was raised using a synthetic peptide corresponding to a region with amino acids GILVPFANSIGALVGLMAGFAISLWVGIGAQIYPPLPERTLPLHLDIQGCPurity:Min. 95%Human Albumin
Please enquire for more information about Human Albumin including the price, delivery time and more detailed product information at the technical inquiry form on this pageHTR7 antibody
HTR7 antibody was raised in rabbit using a synthetic peptide conjugated to KLH as the immunogen.Purity:Min. 95%Lysergic Acid Diethylamide antibody
The Lysergic Acid Diethylamide antibody is a polyclonal antibody that targets and binds to Lysergic Acid Diethylamide (LSD). This antibody is widely used in life sciences research to study the effects of LSD on various biological processes. It has been shown to inhibit the binding of LSD to its target receptors, such as the dopamine receptor and adiponectin receptor. Additionally, this antibody has been used in studies exploring the role of LSD in adipose tissue function, including its effects on adiponectin production and release. Furthermore, it has been utilized to investigate the potential therapeutic applications of LSD as a family kinase inhibitor and its interactions with proteins such as annexin and fibrinogen. The Lysergic Acid Diethylamide antibody is a valuable tool for researchers interested in understanding the mechanisms and physiological effects of LSD.Purity:Min. 95%CTAGE5 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of CTAGE5 antibody, catalog no. 70R-7105Purity:Min. 95%MFNG Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of MFNG antibody, catalog no. 70R-5292
Purity:Min. 95%PPCDC Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of PPCDC antibody, catalog no. 70R-1240Purity:Min. 95%PIGF1 protein
LPAVPPQQWALSAGNGSSEVEVVPFQEVWGRSYCRALERLVDVVSEYPSE VEHMFSPSCVSLLRCTGCCGDENLHCVPVETANVTMQLLKIRSGDRPSYV ELTFSQHVRCECRPLREKMKPERCGDAVPRRPurity:Min. 95%ACE2 peptide library
Angiotensin-converting enzyme 2 (ACE2) is an enzyme involved in the cardiovascular system by decreasing arterial pressure by catalyzing the conversion of angiotensin II to angiotensin (1-7). Angiotensin II is a vasoconstrictor and angiotensin (1-7) is a vasodilatator. This effect makes ACE2 a therapeutic target for cardiovascular disease.
CD9 antibody
The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug from the rifamycins class. It is specifically designed to target tuberculosis infections and contains active compounds that exhibit bactericidal activity. This drug works by binding to DNA-dependent RNA polymerase, thereby preventing transcription and replication of bacteria. It has been extensively tested using the patch-clamp technique on human erythrocytes, proving its high efficacy. Additionally, it undergoes various metabolic transformations, making it highly effective against mycobacterium strains. With its ability to inhibit cell growth and bind to markers expressed in Mycobacterium tuberculosis strains, this drug offers a promising solution for combating tuberculosis infections.Adipophilin (C terminal) antibody
Adipophilin (C terminal) antibody was raised in Guinea Pig using synthetic peptide C-terminal aa 423 - 437 of human adipophilin as the immunogen.Purity:Min. 95%Eotaxin 2 antibody
Eotaxin 2 antibody was raised in goat using highly pure recombinant murine eotaxin-2 as the immunogen.
Purity:Min. 95%C4ORF20 antibody
C4ORF20 antibody was raised using the middle region of C4Orf20 corresponding to a region with amino acids TPVMIGGGVLAHTILGVAWNEITGQIKFLILDPHYTGAEDLQVILEKGWCGFP protein
1-238 amino acids: MSKGEELFTG VVPILVELDG DVNGHKFSVS GEGEGDATYG KLTLKFICTT GKLPVPWPTL VTTFSYGVQC FSRYPDHMKQ HDFFKSAMPE GYVQERTIFF KDDGNYKTRA EVKFEGDTLV NRIELKGIDF KEDGNILGHK LEYNYNSHNV YIMADKQKNG IKVNFKIRHN IEDGSVQLAD HYQQNTPIGD GPVLLPDNHY LSTQSALSKD PNEKRDHMVL LEFVTAAGIT HGMDELYKPurity:Min. 95%SARS-CoV-2 Spike RBM 480-496 peptide
SARS-CoV-2 Spike RBM 480-496 peptide is an epitope of interest of the SARS-CoV-2 Spike S glycoprotein Receptor-Binding Motif (RBM). SARS-CoV-2 Spike RBM 480-496 peptide is useful for vaccine development and for structure-activity relationship studies SARS-CoV-2 Spike (S) glycoprotein Spike (S) glycoprotein corresponds to one of the leading targets for COVID-19 disease. Present on the surface of Sars-CoV-2 virus, Spike S protein is a class I fusion protein that allows the virus to enter host cells. With a 1 273 aa length, Spike protein has 2 subunits : S1 contains the receptor-binding domain RBD and S2 induces the fusion of the viral envelop with the cellular membrane. SARS-CoV-2 Spike RBM: The receptor-binding domain in SARS-CoV-2 Spike protein contains a receptor-binding motif RBM. SARS-CoV-2 Spike RBM is the main functional motif in RBD and allows contacts between the S protein and the Angiotensin-Converting Enzyme receptor 2 (ACE2 receptor) which mediates the viral entry. SB-PEPTIDE also offers SARS-CoV-2 Spike RBM 480-496 (Biotin-LC) peptideGFAP antibody
The GFAP antibody is a highly specialized monoclonal antibody that targets the glial fibrillary acidic protein (GFAP). This antibody is widely used in Life Sciences research to study various aspects of neurobiology and neurodegenerative diseases. It has been proven to be effective in detecting and quantifying GFAP expression in various cell types and tissues.PAPOLG antibody
PAPOLG antibody was raised using a synthetic peptide corresponding to a region with amino acids SVDAIGGESMPIPTIDTSRKKRLPSKELPDSSSPVPANNIRVIKNSIRLT
SARS-CoV-2 Spike RBM 500-509 peptide
SARS-CoV-2 Spike RBM 500-509 peptide is an epitope of interest of the SARS-CoV-2 Spike S glycoprotein Receptor-Binding Motif (RBM). SARS-CoV-2 Spike RBM 500-509 peptide is useful for vaccine development and for structure-activity relationship studies
SARS-CoV-2 Spike (S) glycoprotein
Spike (S) glycoprotein corresponds to one of the leading targets for COVID-19 disease. Present on the surface of Sars-CoV-2 virus, Spike S protein is a class I fusion protein that allows the virus to enter host cells.
With a 1 273 aa length, Spike protein has 2 subunits : S1 contains the receptor-binding domain RBD and S2 induces the fusion of the viral envelop with the cellular membrane.
SARS-CoV-2 Spike RBM:
The receptor-binding domain in SARS-CoV-2 Spike protein contains a receptor-binding motif RBM. SARS-CoV-2 Spike RBM is the main functional motif in RBD and allows contacts between the S protein and the Angiotensin-Converting Enzyme receptor 2 (ACE2 receptor) which mediates the viral entry.
SB-PEPTIDE also offers SARS-CoV-2 Spike RBM 500-509 (Biotin-LC) peptide
