Biochemicals and Reagents
Biochemicals and reagents are fundamental substances for research and development in fields such as biotechnology, molecular biology, pharmacology, and medicine. These products are essential for a variety of applications, including compound synthesis, biological sample analysis, metabolic process research, and drug production. At CymitQuimica, we offer a wide selection of high-quality, high-purity biochemicals and reagents suitable for various scientific and industrial needs. Our catalog includes enzymes, antibodies, nucleic acids, amino acids, and many other products, all designed to support researchers and professionals in their research and development projects, ensuring reliable and reproducible results.
Subcategories of "Biochemicals and Reagents"
- Biomolecules(98,575 products)
- By Biological Target(100,710 products)
- By Pharmacological Effects(6,937 products)
- Cryopreservatives(21 products)
- Desinfectants and Related Compounds(28 products)
- Hormones(421 products)
- Plant Biology(6,907 products)
- Secondary Metabolites(14,367 products)
Found 130493 products of "Biochemicals and Reagents"
Sort by
Purity (%)
0
100
|
0
|
50
|
90
|
95
|
100
OGT Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of OGT antibody, catalog no. 70R-2046Purity:Min. 95%PLS3 antibody
The PLS3 antibody is a highly specialized polyclonal antibody that targets the transferrin receptor in cells. This antibody has been extensively studied and proven to have cytotoxic effects on cancer cells. It specifically recognizes the nuclear antigen, hemagglutinin, and has been shown to inhibit exocytosis in cells. The PLS3 antibody also plays a role in glycosylation processes and has been found to modulate interleukin-6 signaling pathways. This monoclonal antibody is an invaluable tool for researchers studying cell antigens and tyrosine-related processes. With its high specificity and potency, the PLS3 antibody is a crucial component of any immunological research project.hCG_1646157 antibody
hCG_1646157 antibody was raised in rabbit using the middle region of HCG_1646157 as the immunogen
Purity:Min. 95%PPAT antibody
PPAT antibody was raised using the C terminal of PPAT corresponding to a region with amino acids QEGIKFKKQKEKKHDIMIQENGNGLECFEKSGHCTACLTGKYPVELEWGoat anti Mouse IgG (H + L) (Fab'2) (rhodamine)
Goat anti-mouse IgG (H + L) (Fab'2) (Rhodamine) was raised in goat using murine IgG whole molecule as the immunogen.Purity:Min. 95%ZMPSTE24 antibody
ZMPSTE24 antibody was raised using a synthetic peptide corresponding to a region with amino acids LYSETEGTLILLFGGIPYLWRLSGRFCGYAGFGPEYEITQSLVFLLLATLPurity:Min. 95%CRYAB antibody
The CRYAB antibody is a highly specific monoclonal antibody that is used in various applications in the field of Life Sciences. This antibody is designed to target and bind to CRYAB, a protein that plays a crucial role in cellular processes. It has been widely used in research studies to investigate the function of CRYAB and its potential involvement in various diseases.ST14 antibody
ST14 antibody was raised using a synthetic peptide corresponding to a region with amino acids SHVFPAGKAIWVTGWGHTQYGGTGALILQKGEIRVINQTTCENLLPQQIT
BPNT1 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of BPNT1 antibody, catalog no. 70R-3134Purity:Min. 95%BSG antibody
BSG antibody was raised in rabbit using the N terminal of BSG as the immunogenPurity:Min. 95%C7ORF29 antibody
C7ORF29 antibody was raised using the middle region of C7Orf29 corresponding to a region with amino acids VKEIRVSEYSLNSPSPLQSPRGLCVDPTRVAKSSGVEGRSQGEPLQSSSHHistone H3 antibody
The Histone H3 antibody is a powerful tool used in Life Sciences research. It is a monoclonal antibody that specifically targets and binds to Histone H3, a protein involved in DNA packaging and gene regulation. This antibody has been extensively validated for its high specificity and sensitivity in detecting Histone H3 modifications, such as acetylation.
TGF alpha antibody
The TGF alpha antibody is a growth factor that plays a crucial role in collagen synthesis and mitogen-activated protein signaling pathways. It promotes the growth of new blood vessels (microvessel density) and stimulates the production of proteins involved in endothelial cell growth. This antibody specifically targets TGF-beta and interleukin, which are key regulators of cell proliferation and differentiation.EPRS Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of EPRS antibody, catalog no. 70R-3501Purity:Min. 95%DNAI2 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of DNAI2 antibody, catalog no. 70R-8543Purity:Min. 95%SIX1 antibody
The SIX1 antibody is a growth factor that has been extensively studied for its role in various biological processes. It is commonly used in research and diagnostic applications. This monoclonal antibody specifically targets the SIX1 protein, which is involved in the regulation of cell proliferation and differentiation.ZNF169 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of ZNF169 antibody, catalog no. 70R-8768Purity:Min. 95%CYP27C1 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of CYP27C1 antibody, catalog no. 70R-3462Purity:Min. 95%PLK1 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of PLK1 antibody, catalog no. 70R-5563
Purity:Min. 95%FKBP6 protein (His tag)
1-327 amino acids: MGSSHHHHHH SSGLVPRGSH MGGSALNQGV LEGDDAPGQS LYERLSQRML DISGDRGVLK DVIREGAGDL VAPDASVLVK YSGYLEHMDR PFDSNYFRKT PRLMKLGEDI TLWGMELGLL SMRRGELARF LFKPNYAYGT LGCPPLIPPN TTVLFEIELL DFLDCAESDK FCALSAEQQD QFPLQKVLKV AATEREFGNY LFRQNRFYDA KVRYKRALLL LRRRSAPPEE QHLVEAAKLP VLLNLSFTYL KLDRPTIALC YGEQALIIDQ KNAKALFRCG QACLLLTEYQ KARDFLVRAQ KEQPFNHDIN NELKKLASCY RDYVDKEKEM WHRMFAPCGD GSTAGESPurity:Min. 95%Rat Lymphocyte antibody (FITC)
Rat lymphocyte antibody (FITC) was raised in rabbit using RBC-free rat thymus and spleen cells as the immunogen.EFNA3 antibody
The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is an antituberculosis drug that falls under the class of rifamycins. It is highly effective in treating tuberculosis infections due to its bactericidal activity. This active compound works by binding to DNA-dependent RNA polymerase, preventing transcription and replication, thus inhibiting bacterial growth. Additionally, it specifically targets markers expressed in Mycobacterium tuberculosis strains and inhibits cell growth. The metabolization process involves hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. With its potent properties and targeted action, this drug offers promising results in combating tuberculosis.TIP60 antibody
TIP60 antibody was raised in Mouse using a purified recombinant fragment of human TIP60 expressed in E. coli as the immunogen.NOV antibody
NOV antibody was raised using the C terminal of NOV corresponding to a region with amino acids KTIQAEFQCSPGQIVKKPVMVIGTCTCHTNCPKNNEAFLQELELKTTRGK
CAB39 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of CAB39 antibody, catalog no. 70R-3696Purity:Min. 95%
