Biochemicals and Reagents
Biochemicals and reagents are fundamental substances for research and development in fields such as biotechnology, molecular biology, pharmacology, and medicine. These products are essential for a variety of applications, including compound synthesis, biological sample analysis, metabolic process research, and drug production. At CymitQuimica, we offer a wide selection of high-quality, high-purity biochemicals and reagents suitable for various scientific and industrial needs. Our catalog includes enzymes, antibodies, nucleic acids, amino acids, and many other products, all designed to support researchers and professionals in their research and development projects, ensuring reliable and reproducible results.
Subcategories of "Biochemicals and Reagents"
- Biomolecules(98,620 products)
- By Biological Target(100,451 products)
- By Pharmacological Effects(6,928 products)
- Cryopreservatives(21 products)
- Desinfectants and Related Compounds(28 products)
- Hormones(353 products)
- Plant Biology(6,913 products)
- Secondary Metabolites(14,363 products)
Found 130328 products of "Biochemicals and Reagents"
Sort by
Purity (%)
0
100
|
0
|
50
|
90
|
95
|
100
SDS antibody
SDS antibody was raised using the middle region of SDS corresponding to a region with amino acids KITSVAKALGVKTVGAQALKLFQEHPIFSEVISDQEAVAAIEKFVDDEKI
Fibrinogen antibody (HRP)
Fibrinogen antibody (HRP) was raised in sheep using Rabbit Fibrinogen purified from plasma as the immunogen.Mycoplasma pneumoniae antibody
Mycoplasma pneumoniae antibody is a monoclonal antibody that specifically targets the antigen-antibody reaction associated with Mycoplasma pneumoniae infection. This antibody is highly reactive and can effectively neutralize the autoantibodies produced during an infection, reducing cytotoxic effects on host cells. The bioavailability of this antibody is enhanced by its conjugation to cellulose, which allows for targeted delivery to infected cells. In addition to its neutralizing properties, this antibody also activates cell cytotoxicity mechanisms, further enhancing its effectiveness in combating Mycoplasma pneumoniae. Monoclonal Antibodies against annexin A2 have also been developed as therapeutic agents for Mycoplasma pneumoniae infections.TGDS antibody
TGDS antibody was raised using the middle region of TGDS corresponding to a region with amino acids DEVYGGSLDKEFDESSPKQPTNPYASSKAAAECFVQSYWEQYKFPVVITRPPIA antibody
PPIA antibody was raised using a synthetic peptide corresponding to a region with amino acids TAKTEWLDGKHVVFGKVKEGMNIVEAMERFGSRNGKTSKKITIADCGQLEHspb7 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of Hspb7 antibody, catalog no. 70R-8510Purity:Min. 95%CAMK1G antibody
CAMK1G antibody was raised using the middle region of CAMK1G corresponding to a region with amino acids KDFICHLLEKDPNERYTCEKALSHPWIDGNTALHRDIYPSVSLQIQKNFAC19ORF28 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of C19orf28 antibody, catalog no. 70R-6785Purity:Min. 95%RBM4 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of RBM4 antibody, catalog no. 70R-4829Purity:Min. 95%RAD50 antibody
The RAD50 antibody is a collagen-based monoclonal antibody used in bioassays within the Life Sciences field. It is designed for intraocular use and can be immobilized on microspheres or colloidal particles for ultrasensitive detection. This antibody demonstrates high reactivity with human serum, making it an ideal tool for various diagnostic applications. Additionally, the RAD50 antibody can be used in electrode-based assays to detect the presence of growth factors and other biomarkers. Its specificity and reliability have been validated through extensive testing using hybridoma cells that produce this monoclonal antibody.PCBP2 antibody
PCBP2 antibody was raised using a synthetic peptide corresponding to a region with amino acids KKGESVKKMREESGARINISEGNCPERIITLAGPTNAIFKAFAMIIDKLELipoprotein Lipase Antibody
Lipoprotein Lipase Antibody is a potent monoclonal antibody that specifically targets and neutralizes the activity of lipoprotein lipase (LPL). LPL is an enzyme that plays a crucial role in lipid metabolism, particularly in adipose tissue. This antibody has been extensively studied in the field of Life Sciences and has shown promising results in various applications.
Merlin antibody
The Merlin antibody is a highly specialized monoclonal antibody that targets specific proteins involved in various physiological processes. It has been shown to have a significant impact on the regulation of erythropoietin and endothelial growth factor, both of which play crucial roles in cell growth and development. Additionally, the Merlin antibody has been found to interact with androgen receptors, modulating their activity and influencing hormone response.Purity:Min. 95%DDHD2 antibody
DDHD2 antibody was raised using the N terminal of DDHD2 corresponding to a region with amino acids DGWGSTPTEQGRPRTVKRGVENISVDIHCGEPLQIDHLVFVVHGIGPACDHYOU1 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of HYOU1 antibody, catalog no. 70R-6400Purity:Min. 95%Goat anti Human IgA (alpha chain) (HRP)
Goat anti-Human IgA (alpha chain) (HRP) was raised in goat using purified Human IgA as the immunogen.Purity:Min. 95%FLJ44894 antibody
FLJ44894 antibody was raised in rabbit using the middle region of FLJ44894 as the immunogenPurity:Min. 95%FBXO24 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of FBXO24 antibody, catalog no. 70R-2810
Purity:Min. 95%LTK Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of LTK antibody, catalog no. 70R-10027Purity:Min. 95%RNF39 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of RNF39 antibody, catalog no. 70R-3093Purity:Min. 95%UBE2L3 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of UBE2L3 antibody, catalog no. 70R-2746Purity:Min. 95%Factor XI antibody (biotin)
Factor XI antibody (biotin) was raised in goat using human Factor XI purified from plasma as the immunogen.TIMELESS Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of TIMELESS antibody, catalog no. 20R-1199Purity:Min. 95%MAP2K3 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of MAP2K3 antibody, catalog no. 70R-2685
Purity:Min. 95%DDX4 antibody
DDX4 antibody was raised in Mouse using a purified recombinant fragment of human DDX4 expressed in E. coli as the immunogen.
P2ry1 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of P2ry1 antibody, catalog no. 70R-9082Purity:Min. 95%Decorin Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of DCN antibody, catalog no. 70R-5385Purity:Min. 95%ZBTB43 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of ZBTB43 antibody, catalog no. 70R-8305Purity:Min. 95%FSCN3 antibody
FSCN3 antibody was raised in rabbit using the C terminal of FSCN3 as the immunogenPurity:Min. 95%Donkey anti Goat IgG (H + L) (Alk Phos)
Donkey anti-goat IgG (H+L) (Alk Phos) was raised in donkey using goat IgG whole molecule as the immunogen.Purity:Min. 95%7α-Hydroxy-3-oxo-4-cholestenoic acid
CAS:Controlled Product7α-Hydroxy-3-oxo-4-cholestenoic acid is a fatty acid that is synthesized by the liver. This compound has been shown to have health effects, including increasing the production of monoclonal antibodies in mice and protecting brain cells from damage in rats. 7α-Hydroxy-3-oxo-4-cholestenoic acid also has an acidic nature and can form hydrogen ions when metabolized. It can be toxic to humans, with high doses causing liver damage. The metabolites of 7α-hydroxycholesterols are known to play a role in cancer progression and may be involved in the development of malignant melanoma cells.Formula:C27H42O4Purity:Min. 95%Molecular weight:430.62 g/mol
