Biochemicals and Reagents
Biochemicals and reagents are fundamental substances for research and development in fields such as biotechnology, molecular biology, pharmacology, and medicine. These products are essential for a variety of applications, including compound synthesis, biological sample analysis, metabolic process research, and drug production. At CymitQuimica, we offer a wide selection of high-quality, high-purity biochemicals and reagents suitable for various scientific and industrial needs. Our catalog includes enzymes, antibodies, nucleic acids, amino acids, and many other products, all designed to support researchers and professionals in their research and development projects, ensuring reliable and reproducible results.
Subcategories of "Biochemicals and Reagents"
- Biomolecules(98,622 products)
- By Biological Target(100,423 products)
- By Pharmacological Effects(6,927 products)
- Cryopreservatives(21 products)
- Desinfectants and Related Compounds(28 products)
- Hormones(353 products)
- Plant Biology(6,913 products)
- Secondary Metabolites(14,362 products)
Found 130307 products of "Biochemicals and Reagents"
Sort by
Purity (%)
0
100
|
0
|
50
|
90
|
95
|
100
SMN1 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of SMN1 antibody, catalog no. 70R-4672Purity:Min. 95%ANKRD9 antibody
ANKRD9 antibody was raised using the middle region of ANKRD9 corresponding to a region with amino acids RARVLDRRGCSRVEGGGTSLHVACELARPECLFLLLGHGASPGLRDGGGL
PROCR antibody
The PROCR antibody is a highly stable liquid formulation that contains active agents for various applications in the field of life sciences. This antibody is designed to specifically target and bind to the PROCR cell antigen, which plays a crucial role in pluripotent stem cell differentiation and development. The PROCR antibody can be used for applications such as polymerase chain reaction (PCR), cell lysis, and detection of PROCR expression levels. It is available in both polyclonal and monoclonal forms, providing researchers with options to suit their specific needs. With its high specificity and sensitivity, this antibody is an essential tool for studying PROCR-related processes and exploring potential therapeutic applications. Whether you are conducting research or developing diagnostic assays, the PROCR antibody offers reliable results and consistent performance.
RGS20 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of RGS20 antibody, catalog no. 70R-1129Purity:Min. 95%Oxycodone antibody
The Oxycodone antibody is a specific monoclonal antibody that has cytotoxic properties. It is designed to specifically target and neutralize oxycodone, a potent opioid pain medication. This antibody works by binding to the oxycodone molecules and preventing them from interacting with their target receptors in the body. This not only reduces the analgesic effects of oxycodone but also helps to minimize its potential for abuse and addiction. The Oxycodone antibody has been extensively tested in various preclinical models and has shown promising results in reducing the effects of oxycodone overdose. It has the potential to be used as an effective therapeutic option for managing opioid addiction and overdose cases.Purity:Min. 95%Rabbit anti Sheep IgG (Alk Phos)
Rabbit anti-sheep IgG (Alk Phos) was raised in rabbit using sheep IgG F(ab')2 fragment as the immunogen.Purity:Min. 95%GFR alpha antibody
The GFR alpha antibody is a highly effective antiviral agent that targets low-density lipoprotein lipase and transferrin. This polyclonal antibody is specifically designed to bind to collagen and electrodes, making it an ideal tool for various research applications in the life sciences field. Additionally, this monoclonal antibody has shown promising results in inhibiting interferon production and neutralizing viral activity. With its ability to interact with chimeric proteins and fatty acids, the GFR alpha antibody offers a versatile solution for studying immune responses and developing therapeutic interventions. It is extensively tested and validated in human serum samples, ensuring reliable and accurate results. Choose this exceptional antibody for your research needs today.Androgen receptor antibody
Androgen receptor antibody was raised in Mouse using a purified recombinant fragment of human AR expressed in E. coli as the immunogen.CHRNB2 antibody
CHRNB2 antibody was raised in rabbit using the N terminal of CHRNB2 as the immunogenPurity:Min. 95%MKK3 antibody
The MKK3 antibody is a highly specialized monoclonal antibody that targets the growth hormone receptor and progesterone. It is commonly used in immunoassays and research studies within the field of Life Sciences. This antibody specifically binds to MKK3, a phosphatase enzyme involved in various cellular processes such as chemokine signaling and interferon response. The MKK3 antibody has been extensively validated for its specificity and sensitivity in detecting activated MKK3 in human serum samples. Additionally, it can be utilized as a valuable tool for studying the role of MKK3 in different biological pathways and for developing potential inhibitors targeting this enzyme. With its high-quality performance, this polyclonal antibody is an essential component for any researcher working in the field of Life Sciences.
CKMB Antibody
The CKMB Antibody is a highly specific monoclonal antibody that targets the CKMB isoenzyme, a marker for creatine kinase. This antibody is widely used in Life Sciences research and clinical diagnostics to detect and quantify CKMB levels in various samples such as human serum, adipose tissue, and mesenchymal stem cells. The CKMB Antibody is commonly used in immunoassays, where it can be utilized as a primary antibody for detection or as a neutralizing antibody to inhibit enzyme activity. Its high affinity and specificity make it an excellent tool for the immobilization of CKMB on surfaces such as electrodes or beads for various applications. Researchers and clinicians rely on the CKMB Antibody to accurately measure CKMB levels, aiding in the diagnosis and monitoring of diseases such as myocardial infarction. With its exceptional performance and versatility, this antibody is an indispensable tool in the field of molecular biology and biomedical research.PPAT Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of PPAT antibody, catalog no. 70R-2079Purity:Min. 95%UTP14A antibody
UTP14A antibody was raised using a synthetic peptide corresponding to a region with amino acids KWDPVVLKNRQAEQLVFPLEKEEPAIAPIEHVLSGWKARTPLEQEIFNLLFGF2 antibody
The FGF2 antibody is a cytotoxic agent that targets the growth factor known as FGF2. It is commonly used in Life Sciences research to neutralize the effects of FGF2 on various cellular processes. This polyclonal antibody specifically binds to FGF2, preventing its interaction with cell surface receptors and inhibiting downstream signaling pathways. Additionally, the FGF2 antibody has been shown to have neutralizing effects on other growth factors such as TGF-beta and natriuretic peptides. This antibody is available in both monoclonal and polyclonal forms, providing researchers with options for their specific experimental needs. In addition to its research applications, the FGF2 antibody can also be used as a therapeutic agent for certain diseases by targeting cells expressing high levels of FGF2, such as adipose tissue or cancer cells.WNT3 antibody
WNT3 antibody was raised using the middle region of WNT3 corresponding to a region with amino acids SHHKGPPGEGWKWGGCSEDADFGVLVSREFADARENRPDARSAMNKHNNEPHF5A antibody
The PHF5A antibody is a polyclonal antibody that has inhibiting properties. It is used as an anti-proliferative agent in the field of medicine. This antibody can bind to specific proteins and biomarkers, making it a valuable detection reagent in life sciences research. The PHF5A antibody has been shown to inhibit the activity of certain proteins, such as adeno-associated virus (AAV) and polypeptide, which are involved in cell proliferation. This makes it a promising tool for studying the mechanisms of cell growth and development. Additionally, this antibody can be used to detect autoantibodies and inhibitors that may be present in biological samples. With its wide range of applications, the PHF5A antibody is an essential tool for researchers in various fields.Histone H2B antibody
The Histone H2B antibody is an essential tool in the field of Life Sciences. It is an antigen that specifically recognizes and binds to activated histone H2B, a peptidyl-prolyl isomerase involved in various cellular processes. This antibody has been extensively used in research studies to investigate the role of histone modifications and chromatin structure in gene expression, DNA replication, and repair.C12ORF42 antibody
C12ORF42 antibody was raised using the N terminal Of C12Orf42 corresponding to a region with amino acids PRCSVSTVSFDEESYEEFRSSPAPSSETDEAPLIFTARGETEERARGAPKFrizzled 5 antibody
The Frizzled 5 antibody is a highly specialized antibody that can be used in various life science research applications. It is available in both polyclonal and monoclonal forms, providing researchers with flexibility in their experiments.
PSG5 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of PSG5 antibody, catalog no. 70R-1582Purity:Min. 95%TAP1 Antibody
The TAP1 Antibody is a powerful tool used in Life Sciences research. This monoclonal antibody specifically targets the TAP1 protein isoforms, which play a crucial role in antigen presentation and immune response. By binding to the TAP1 protein, this antibody allows for the detection and analysis of threonine phosphorylation and other post-translational modifications.Goat anti Rat IgG (H + L) (HRP)
Goat anti-rat IgG (H+L) (HRP) was raised in goat using rat IgG whole molecule as the immunogen.Purity:Min. 95%Nanog antibody
Nanog antibody was raised in Mouse using a purified recombinant fragment of Nanog (aa20-166) expressed in E. coli as the immunogen.AADACL4 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of AADACL4 antibody, catalog no. 70R-6671Purity:Min. 95%Claudin 7 antibody
The Claudin 7 antibody is a powerful tool in the field of life sciences. This antibody specifically targets and binds to Claudin 7, an important protein involved in endothelial growth and activation. It can be used in various applications such as immunohistochemistry and polymerase chain reaction (PCR) to study the expression and localization of Claudin 7 in different tissues and cell types.C17ORF71 antibody
C17ORF71 antibody was raised using the middle region of C17Orf71 corresponding to a region with amino acids HCVHKFHSLPKSGEKPEADRNPPVLYHNSRARSTGACNCGRKQAPRDDPF
USP17L2 antibody
USP17L2 antibody was raised in rabbit using the middle region of USP17L2 as the immunogen
Purity:Min. 95%OR13C5 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of OR13C5 antibody, catalog no. 70R-7955Purity:Min. 95%PSMA4 antibody
The PSMA4 antibody is a highly specialized antibody used in Life Sciences research. It is colloidal in nature and specifically targets VEGF, c-myc, and other growth factors. This polyclonal antibody has been extensively tested and validated for its efficacy in various applications, including electrophoresis and immunohistochemistry.ANKRD13D antibody
ANKRD13D antibody was raised using the middle region of ANKRD13D corresponding to a region with amino acids ARPPPQATVYEEQLQLERALQESLQLSTEPRGPGSPPRTPPAPGPPSFEEOTUB1 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of OTUB1 antibody, catalog no. 70R-4421Purity:Min. 95%RXRA Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of RXRA antibody, catalog no. 70R-1923Purity:Min. 95%Goat anti Human IgG (H + L) (rhodamine)
Goat anti-human IgG (H+L) (Rhodamine) was raised in goat using human IgG whole molecule as the immunogen.Purity:Min. 95%
