Biochemicals and Reagents
Biochemicals and reagents are fundamental substances for research and development in fields such as biotechnology, molecular biology, pharmacology, and medicine. These products are essential for a variety of applications, including compound synthesis, biological sample analysis, metabolic process research, and drug production. At CymitQuimica, we offer a wide selection of high-quality, high-purity biochemicals and reagents suitable for various scientific and industrial needs. Our catalog includes enzymes, antibodies, nucleic acids, amino acids, and many other products, all designed to support researchers and professionals in their research and development projects, ensuring reliable and reproducible results.
Subcategories of "Biochemicals and Reagents"
- Biomolecules(98,569 products)
- By Biological Target(100,661 products)
- By Pharmacological Effects(6,934 products)
- Cryopreservatives(21 products)
- Desinfectants and Related Compounds(28 products)
- Hormones(362 products)
- Plant Biology(6,908 products)
- Secondary Metabolites(14,364 products)
Found 130473 products of "Biochemicals and Reagents"
Sort by
Purity (%)
0
100
|
0
|
50
|
90
|
95
|
100
Human Serum Albumin antibody
Human serum albumin antibody was raised in rabbit using human serum albumin as the immunogen.
Purity:Min. 95%ZNF682 antibody
ZNF682 antibody was raised in rabbit using the N terminal of ZNF682 as the immunogenPurity:Min. 95%PSG3 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of PSG3 antibody, catalog no. 70R-1279
Purity:Min. 95%Bnc2 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of Bnc2 antibody, catalog no. 70R-8331Purity:Min. 95%LOX antibody
The LOX antibody is a glycoprotein that is found in human serum and has been shown to have various functions. It plays a role in regulating the activity of mesenchymal stem cells and can interact with fibrinogen. The LOX antibody is a monoclonal antibody that is capable of neutralizing the effects of LOX. Monoclonal antibodies are highly specific and can be used for various applications in the field of Life Sciences. The LOX antibody can be produced using an expression plasmid and can be immobilized on a carbon electrode for use in electrochemical assays. This antibody has potential applications in research, diagnostics, and therapeutics, particularly in the study of chemokines and their role in various diseases.XYLT1 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of XYLT1 antibody, catalog no. 70R-8826Purity:Min. 95%SCFD1 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of SCFD1 antibody, catalog no. 70R-3833Purity:Min. 95%Beta catenin antibody
The Beta catenin antibody is a protein that plays a crucial role in various biological processes, including cell adhesion and signaling. It interacts with other proteins such as fibronectin, alpha-fetoprotein, and interferon to regulate cell growth and development. This antibody is widely used in Life Sciences research to study the function of β-catenin and its involvement in different cellular pathways.Purity:Min. 95%Goat anti Human IgG (H + L) (FITC)
This antibody reacts with heavy chains on human IgG (gamma chain) and light chains on all human immunoglobulins.Purity:Min. 95%C11orf16 antibody
C11orf16 antibody was raised in rabbit using the middle region of C11orf16 as the immunogenPurity:Min. 95%BAG4 antibody
The BAG4 antibody is a highly specialized antibody used in the field of Life Sciences. It is a polyclonal antibody that has been extensively studied and proven to be effective in various research applications. This antibody specifically targets BAG family molecular chaperone regulator 4 (BAG4), which plays a crucial role in cell signaling and regulation.
Goat anti Human κ Chain (biotin)
Goat anti-human kappa chain (biotin) was raised in goat using human kappa chain as the immunogen.Purity:Min. 95%Rat anti Mouse IgE (biotin)
Mouse IgE antibody (biotin) was raised in rat using murine IgE as the immunogen.
VPS26B antibody
VPS26B antibody was raised using a synthetic peptide corresponding to a region with amino acids AGYELTPTMRDINKKFSVRYYLNLVLIDEEERRYFKQQEVVLWRKGDIVRPeptidase D Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of PEPD antibody, catalog no. 70R-4294Purity:Min. 95%YAP antibody
The YAP antibody is a highly specific and potent polyclonal antibody that is used for the quantitation and detection of YAP (Yes-associated protein) in various immunoassays. It is commonly used in research laboratories for the study of anti-angiogenesis, as well as for the treatment and/or prophylaxis of diseases associated with YAP overexpression. The YAP antibody can be immobilized on streptavidin-coated surfaces or used in conjunction with other antibodies, such as monoclonal antibodies, for enhanced specificity and sensitivity. It has been extensively tested and validated using human serum samples, making it a reliable tool for accurate measurement of YAP levels. Whether you are conducting basic research or developing inhibitors targeting this important glycoprotein, the YAP antibody is an essential tool that will provide you with reliable and reproducible results.HNRPA1 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of HNRPA1 antibody, catalog no. 70R-1312Purity:Min. 95%APPL1 antibody
The APPL1 antibody is a globulin protein used in Life Sciences research. It specifically targets messenger RNA (mRNA) and plays a crucial role in various biological processes. This monoclonal antibody has been shown to interact with influenza hemagglutinin, which is involved in viral entry into host cells. Additionally, the APPL1 antibody is known to regulate iron homeostasis and hepatocyte growth, making it an essential tool for studying these processes. It can also be used to detect glycoproteins, such as fibrinogen, and has applications in Polyclonal Antibodies research. Furthermore, this antibody has been used to study proteins involved in steroid metabolism and ferritin synthesis. Its ability to neutralize oxidative damage makes it a valuable asset for investigating cellular responses to stress.TNFSF11 antibody
The TNFSF11 antibody is a polyclonal antibody commonly used in life sciences research. It is an essential protein reagent that plays a crucial role in various biological processes. This antibody specifically targets the TNFSF11 protein, also known as RANKL (Receptor Activator of Nuclear Factor Kappa-B Ligand).
TUSC2 antibody
The TUSC2 antibody is a highly versatile product used in the field of Life Sciences. It is derived from recombinant allergens and exhibits strong binding capabilities to specific polypeptide sequences. This antibody has been extensively studied and proven effective in various applications.PERP antibody
PERP antibody was raised in rabbit using residues 37-50 of the human PERP protein as the immunogen.Purity:Min. 95%Ezrin antibody
The Ezrin antibody is a powerful tool used in Life Sciences research. This antibody specifically targets and binds to ezrin, a protein that plays a crucial role in cellular processes such as cell adhesion, migration, and signal transduction. By binding to ezrin, this antibody allows researchers to study the function and localization of this protein within cells.Purity:Min. 95%Lp (a) Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of LPA antibody, catalog no. 70R-10024Purity:Min. 95%PCDHGB1 antibody
PCDHGB1 antibody was raised using the N terminal of PCDHGB1 corresponding to a region with amino acids SPDGSKYPVLLLEKPLDREHQSSHRLILTAMDGGDPPLSGTTHIWIRVTDPurity:Min. 95%FLJ20433 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of FLJ20433 antibody, catalog no. 70R-3418Purity:Min. 95%Stabilizing Buffer (Casein based)
Drying Buffer/Stabilizer, biotin-free, casein based, ready-to-usePurity:Min. 95%
