Biochemicals and Reagents
Biochemicals and reagents are fundamental substances for research and development in fields such as biotechnology, molecular biology, pharmacology, and medicine. These products are essential for a variety of applications, including compound synthesis, biological sample analysis, metabolic process research, and drug production. At CymitQuimica, we offer a wide selection of high-quality, high-purity biochemicals and reagents suitable for various scientific and industrial needs. Our catalog includes enzymes, antibodies, nucleic acids, amino acids, and many other products, all designed to support researchers and professionals in their research and development projects, ensuring reliable and reproducible results.
Subcategories of "Biochemicals and Reagents"
- Biomolecules(98,569 products)
- By Biological Target(100,669 products)
- By Pharmacological Effects(6,934 products)
- Cryopreservatives(21 products)
- Desinfectants and Related Compounds(28 products)
- Hormones(369 products)
- Plant Biology(6,909 products)
- Secondary Metabolites(14,364 products)
Found 130473 products of "Biochemicals and Reagents"
Sort by
Purity (%)
0
100
|
0
|
50
|
90
|
95
|
100
C19ORF47 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of C19orf47 antibody, catalog no. 70R-3316Purity:Min. 95%ATG9B Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of ATG9B antibody, catalog no. 70R-9615Purity:Min. 95%CACNB2 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of CACNB2 antibody, catalog no. 70R-8062Purity:Min. 95%CDK2 antibody
The CDK2 antibody is a highly specialized Polyclonal Antibody used in Life Sciences research. It is designed to target and bind to the cyclin-dependent kinase 2 (CDK2) protein, which plays a crucial role in cell cycle regulation and proliferation. This antibody has been extensively tested and validated for its specificity and sensitivity in various applications.ANXA1 antibody
The ANXA1 antibody is a monoclonal antibody that specifically targets and binds to Annexin A1 (ANXA1), a protein involved in various cellular processes. This antibody has been extensively studied in the field of life sciences and has shown promising applications in research and diagnostics.c-Kit antibody
The c-Kit antibody is a highly specialized product used in the field of Life Sciences. This antibody targets the c-Kit protein, which plays a crucial role in cell growth and differentiation. By binding to c-Kit, this antibody can effectively inhibit the activity of this protein, making it an essential tool for researchers studying various cellular processes.Purity:Min. 95%RAD9B Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of RAD9B antibody, catalog no. 70R-5622Purity:Min. 95%KIF23 antibody
KIF23 antibody was raised using the middle region of KIF23 corresponding to a region with amino acids KDEKLKQLKAIVTEPKTEKPERPSRERDREKVTQRSVSPSPVPLLFQPDQPurity:Min. 95%TUSC1 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of TUSC1 antibody, catalog no. 70R-2591Purity:Min. 95%Irx6 antibody
Irx6 antibody was raised in rabbit using the middle region of Irx6 as the immunogenPurity:Min. 95%RNASE9 antibody
RNASE9 antibody was raised using a synthetic peptide corresponding to a region with amino acids PEEDKKEEFEECLEKFFSTGPARPPTKEKVKRRVLIEPGMPLNHIEYCNHNKAIN4 antibody
NKAIN4 antibody was raised using the middle region of NKAIN4 corresponding to a region with amino acids LLGFVCGCQVVSVFTDEEDSFDFIGGFDPFPLYHVNEKPSSLLSKQVYLPPurity:Min. 95%Mouse anti Human IgE (HRP)
Mouse anti human IgE (HRP) was raised in mouse using human IgE as the immunogen.SPZ1 antibody
SPZ1 antibody was raised in rabbit using the C terminal of SPZ1 as the immunogenPurity:Min. 95%Mcm10 antibody
Mcm10 antibody was raised in rabbit using the N terminal of Mcm10 as the immunogenPurity:Min. 95%IKB alpha antibody
The IKB alpha antibody is a polyclonal antibody used in Life Sciences for various applications. It is designed to target the epidermal growth factor and has been widely used in research studies. This antibody can be used to detect autoantibodies and glucan synthase in pharmaceutical preparations. With its high specificity and sensitivity, it is an essential tool for studying cell antibodies and low-molecular-weight chimeric proteins. The IKB alpha antibody is available as a monoclonal antibody, making it an ideal choice for researchers looking for a reliable medicament. Its ability to target growth factors and localize to the apical membrane makes it suitable for a wide range of experiments. Trust the IKB alpha antibody to deliver accurate and reproducible results in your research endeavors.Purity:Min. 95%Angiopoietin 2 antibody
Angiopoietin 2 antibody was raised in rabbit using a synthetic peptide corresponding to a region of mouse Angiopietin-2 protein conjugated to KLH as the immunogen.Purity:Min. 95%XAB2 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of XAB2 antibody, catalog no. 70R-8952Purity:Min. 95%PSMC3IP Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of PSMC3IP antibody, catalog no. 70R-8725Purity:Min. 95%MCTS1 antibody
MCTS1 antibody was raised using the N terminal of MCTS1 corresponding to a region with amino acids MFKKFDEKENVSNCIQLKTSVIKGIKNQLIEQFPGIEPWLNQIMPKKDPVPurity:Min. 95%PTPN5 antibody
PTPN5 antibody was raised using a synthetic peptide corresponding to a region with amino acids VPETPVFDCVMDIKPEADPTSLTVKSMGLQERRGSNVSLTLDMCTPGCNEPurity:Min. 95%TIMP3 antibody
TIMP3 antibody was raised in mouse using a sythetic peptide corresponding to amino acid residues 170-188 of human TIMP-3 as the immunogen.HMGCLL1 antibody
HMGCLL1 antibody was raised using the N terminal of HMGCLL1 corresponding to a region with amino acids MGNVPSAVKHCLSYQQLLREHLWIGDSVAGALDPAQETSQLSGLPEFVKI
DUS1L antibody
DUS1L antibody was raised using a synthetic peptide corresponding to a region with amino acids KPTGDLPFHWICQPYIRPGPREGSKEKAGARSKRALEEEEGGTEVLSKNKCLEC4M antibody
CLEC4M antibody was raised using the middle region of CLEC4M corresponding to a region with amino acids NRFSWMGLSDLNQEGTWQWVDGSPLSPSFQRYWNSGEPNNSGNEDCAEFSPurity:Min. 95%Rabbit anti Rat IgM (Texas Red)
Rabbit anti-rat IgM was raised in rabbit using rat IgM mu chain as the immunogen.Purity:Min. 95%PR antibody
PR antibody is a molecular docking agent that specifically targets adipose tissue. It has been shown to have an inhibitory effect on phosphatase activity, making it a promising therapeutic option for various diseases. PR antibody is available in both monoclonal and polyclonal forms, allowing for customized treatment options. This antibody can be immobilized and used as a medicament in the field of Life Sciences. Additionally, PR antibody has shown antidiabetic properties and has been found to bind to c-myc, a protein involved in cell growth and division. With its versatile applications and targeted effects, PR antibody is a valuable tool in the field of molecular research and drug development.
Midkine antibody
Midkine antibody was raised in rabbit using highly pure recombinant human Midkine as the immunogen.Purity:Min. 95%KHDRBS1 antibody
KHDRBS1 antibody was raised using the N terminal of KHDRBS1 corresponding to a region with amino acids LPELMAEKDSLDPSFTHAMQLLTAEIEKIQKGDSKKDDEENYLDLFSHKN
Purity:Min. 95%
