Biochemicals and Reagents
Biochemicals and reagents are fundamental substances for research and development in fields such as biotechnology, molecular biology, pharmacology, and medicine. These products are essential for a variety of applications, including compound synthesis, biological sample analysis, metabolic process research, and drug production. At CymitQuimica, we offer a wide selection of high-quality, high-purity biochemicals and reagents suitable for various scientific and industrial needs. Our catalog includes enzymes, antibodies, nucleic acids, amino acids, and many other products, all designed to support researchers and professionals in their research and development projects, ensuring reliable and reproducible results.
Subcategories of "Biochemicals and Reagents"
- Biomolecules(98,569 products)
- By Biological Target(100,661 products)
- By Pharmacological Effects(6,934 products)
- Cryopreservatives(21 products)
- Desinfectants and Related Compounds(28 products)
- Hormones(362 products)
- Plant Biology(6,908 products)
- Secondary Metabolites(14,364 products)
Found 130473 products of "Biochemicals and Reagents"
Sort by
Purity (%)
0
100
|
0
|
50
|
90
|
95
|
100
MGC87631 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of MGC87631 antibody, catalog no. 70R-4558Purity:Min. 95%Mitofusin 1 antibody
Mitofusin 1 antibody was raised using the middle region of MFN1 corresponding to a region with amino acids QVDITQKQLEEEIARLPKEIDQLEKIQNNSKLLRNKAVQLENELENFTKQWDHD1 antibody
The WDHD1 antibody is a highly specialized antibody that is used as an inhibitor in various medical applications. It is commonly used in research laboratories and pharmaceutical companies for its ability to target specific proteins within the body. This antibody can be used in conjunction with adeno-associated viruses to deliver medicaments directly into the nucleus of cells. Additionally, it has been shown to have a high affinity for interleukins, making it an excellent tool for studying immune responses and inflammatory processes. The WDHD1 antibody is widely used in the field of life sciences and has proven to be a valuable asset in the development of new medicines and therapies.TMC8 antibody
TMC8 antibody was raised using the N terminal of TMC8 corresponding to a region with amino acids PGPTLNLTLQCPGSRQSPPGVLRFHNQLWHVLTGRAFTNTYLFYGAYRVGPRPS2 antibody
PRPS2 antibody was raised using the N terminal of PRPS2 corresponding to a region with amino acids PNIVLFSGSSHQDLSQRVADRLGLELGKVVTKKFSNQETSVEIGESVRGE
Klotho Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of KL antibody, catalog no. 70R-7522Purity:Min. 95%PITPNB antibody
PITPNB antibody was raised using the middle region of PITPNB corresponding to a region with amino acids FFIKIETWHKPDLGTLENVHGLDPNTWKTVEIVHIDIADRSQVEPADYKAC3ORF19 antibody
C3ORF19 antibody was raised using the middle region of C3Orf19 corresponding to a region with amino acids RQQWEEEEREALKRPMGPVHYEDIRENEARQLGVGYFAFARDKELRNKQMHCC1 protein
Region of HCC1 protein corresponding to amino acids GPYHPSECCF TYTTYKIPRQ RIMDYYETNS QCSKPGIVFI TKRGHSVCTN PSDKWVQDYI KDMKEN.Purity:Min. 95%GSG1 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of GSG1 antibody, catalog no. 70R-3370
Purity:Min. 95%Goat anti Human kappa chain
This antibody reacts with kappa light chains on human immunoglobulins.Purity:Min. 95%HOMER1 antibody
HOMER1 antibody was raised using a synthetic peptide corresponding to a region with amino acids EKFQEFKEAARLAKEKSQEKMELTSTPSQESAGGDLQSPLTPESINGTDDRBM35A antibody
RBM35A antibody was raised using the N terminal of RBM35A corresponding to a region with amino acids MTEYLNFEKSSSVSRYGASQVEDMGNIILAMISEPYNHRFSDPERVNYKFTIMP4 antibody
TIMP4 antibody was raised in rabbit using the middle region of TIMP4 as the immunogenPurity:Min. 95%FAM116A antibody
FAM116A antibody was raised using the middle region of FAM116A corresponding to a region with amino acids KPGVYTSYKPYLNRDEEIIKQLQKGVQQKRPSEAQSVILRRYFLELTQSFIL15 protein
IL15 protein is a glycoprotein that belongs to the family of interleukins. It plays a crucial role in the immune system by promoting the proliferation and activation of natural killer cells and CD8+ T cells. IL15 protein has been used in various research applications, including as an anticoagulant in neonatal serum studies and as an electrode coating for monoclonal antibody immobilization. Recombinant IL15 protein is widely used in life sciences for studying its biological functions and developing therapeutic strategies. It has also been investigated as a potential component of DNA vaccines due to its ability to induce strong immune responses. Additionally, IL15 protein has shown neutralizing effects against autoantibodies, such as antiphospholipid antibodies, making it a promising candidate for autoimmune disease research.
Purity:Min. 95%MKNK1 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of MKNK1 antibody, catalog no. 70R-10043Purity:Min. 95%JDP2 antibody
The JDP2 antibody is a highly valuable product in the field of Life Sciences. It is a test compound that has shown promising results as an inhibitor with anti-thrombotic properties. This antibody specifically targets isolated retinal cells and has been proven to be effective in various research studies.Cortactin antibody
The Cortactin antibody is a highly specialized product that plays a crucial role in various scientific and medical applications. This antibody specifically targets the EBNA1 protein, which is involved in the regulation of gene expression and immune response. By binding to EBNA1, this antibody can modulate its activity and potentially inhibit its function.FTHL17 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of FTHL17 antibody, catalog no. 70R-6380Purity:Min. 95%BMP2 protein
The BMP2 protein is a recombinant protein that plays a crucial role in various life sciences applications. It is an isolated nucleic acid that encodes the bone morphogenetic protein 2 (BMP2), which is a growth factor involved in bone and cartilage development. This cyclic peptide has anticoagulant properties and has been shown to neutralize interleukin-6 (IL-6) and transforming growth factor-beta 1 (TGF-β1). The BMP2 protein can be used in research to study the effects of these factors on cellular processes, as well as in diagnostic assays to detect antigen-antibody reactions. Additionally, it has been found to have interactions with other proteins such as hepcidin and phosphatase, further expanding its potential applications in the field of Proteins and Antigens.Purity:Min. 95%LY96 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of LY96 antibody, catalog no. 70R-10270
Purity:Min. 95%ZNF14 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of ZNF14 antibody, catalog no. 70R-3249Purity:Min. 95%ZBTB46 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of ZBTB46 antibody, catalog no. 70R-8971Purity:Min. 95%Rotavirus antibody (FITC)
Rotavirus antibody (FITC) was raised in goat using nebraska calf diarrhea virus as the immunogen.DOK4 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of DOK4 antibody, catalog no. 70R-10015Purity:Min. 95%Goat anti Human Serum antibody (Whole)
Human serum antibody (Whole) was raised in using human whole serum as the immunogen.Purity:Min. 95%PLEKHO1 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of PLEKHO1 antibody, catalog no. 70R-4482
Purity:Min. 95%UBE3B Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of UBE3B antibody, catalog no. 70R-2574Purity:Min. 95%SLC43A3 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of SLC43A3 antibody, catalog no. 70R-1888Purity:Min. 95%CDC42EP4 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of CDC42EP4 antibody, catalog no. 70R-2900Purity:Min. 95%GCLM Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of GCLM antibody, catalog no. 70R-3355Purity:Min. 95%MUC1 antibody
The MUC1 antibody is a highly specialized monoclonal antibody that targets the MUC1 glycoprotein. This glycoprotein plays a crucial role in various biological processes, including cell adhesion, signal transduction, and immune response modulation. The MUC1 antibody has been extensively studied in the field of Life Sciences and has shown promising results in research related to helicobacter infection, erythropoietin receptor signaling, epidermal growth factor regulation, and collagen synthesis.
CACNA1I Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of CACNA1I antibody, catalog no. 70R-5133Purity:Min. 95%DHFRL1 antibody
DHFRL1 antibody was raised using the middle region of DHFRL1 corresponding to a region with amino acids RINLVLSRELKEPPQGAHFLARSLDDALKLTERPELANKVDMIWIVGGSSCASP6 antibody
CASP6 antibody was raised in rabbit using the middle region of CASP6 as the immunogenPurity:Min. 95%
