Biochemicals and Reagents

<p>C19orf2 antibody was raised in rabbit using the middle region of C19ORF2 as the immunogen</p>

<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a potent antituberculosis drug that falls under the class of rifamycins. Specifically designed for the treatment of tuberculosis infection, this active compound exhibits strong bactericidal activity. By binding to DNA-dependent RNA polymerase, it effectively inhibits bacterial growth, preventing transcription and replication. The effectiveness of this drug has been demonstrated through extensive research using the patch-clamp technique on human erythrocytes. Metabolized through various metabolic transformations, including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid, it offers a multifaceted approach to combatting tuberculosis. Additionally, its ability to specifically bind to markers expressed at high levels in Mycobacterium tuberculosis strains and inhibit cell growth makes it a promising option for treatment. Experience the power</p>

<p>Mouse monoclonal OXSR1 antibody</p>

<p>ADD3 antibody was raised in Rabbit using Human ADD3 as the immunogen</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of IGSF1 antibody, catalog no. 70R-6153</p>

<p>Mouse monoclonal ITFG2 antibody</p>

<p>Rabbit polyclonal AHSA1 antibody (biotin)</p>

<p>49-162 amino acids: MRGSHHHHHH GMASMTGGQQ MGRDLYDDDD KDRWGSHMAV QGPEETVTQD CLQLIADSET PTIQKGSYTF VPWLLSFKRG SALEEKENKI LVKETGYFFI YGQVLYTDKT YAMGHLIQRK KVHVFGDELS LVTLFRCIQN MPETLPNNSC YSAGIAKLEE GDELQLAIPR ENAQISLDGD VTFFGALKLL</p>

<p>HDAC3 antibody was raised in Mouse using a purified recombinant fragment of human HDAC3 (aa224-428) expressed in E. coli as the immunogen.</p>

<p>Goat anti-cat IgG (H+L) (Alk Phos) was raised in goat using feline IgG whole molecule as the immunogen.</p>

<p>Galactocerebrosidase protein is a glycan that plays a crucial role in various biological processes. It is involved in the breakdown of galactocerebroside, a major component of myelin, which is essential for the proper functioning of the nervous system. This protein has been extensively studied and its characteristics make it a valuable tool in Life Sciences research.</p>

<p>Filamin A antibody was raised in mouse using human platelet protein as the immunogen.</p>

<p>Affinity purified Rabbit polyclonal OSGEP antibody</p>

<p>Rabbit polyclonal TAF6L antibody</p>

<p>LCAT antibody was raised using the C terminal of LCAT corresponding to a region with amino acids GVLYEDGDDTVATRSTELCGLWQGRQPQPVHLLPLHGIQHLNMVFSNLTL</p>

<p>GPR171 antibody was raised in rabbit using a synthetic peptide conjugated to KLH as the immunogen.</p>

<p>BCO2 antibody was raised in rabbit using the C terminal of BCO2 as the immunogen</p>

<p>PNU-177864 is a peptide that inhibits the activity of the Kv1.3 channel, which is an ion channel that regulates potassium ion flow across the cell membrane. This inhibition has been shown to reduce the release of neurotransmitters such as glutamate and glycine, which are thought to be involved in the development of chronic pain. PNU-177864 has also been shown to activate a number of receptors, including opioid receptors and serotonin receptors. The receptor activation leads to inhibition of protein synthesis and cellular proliferation.</p>

<p>Purified recombinant LENEP protein</p>

<p>Mouse monoclonal PDSS2 antibody</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of CDCA5 antibody, catalog no. 70R-2883</p>

<p>IDS antibody was raised in rabbit using the N terminal of IDS as the immunogen</p>

<p>DDX20 antibody was raised in Rabbit using Human DDX20 as the immunogen</p>

<p>Rabbit polyclonal ZNF3 antibody</p>

<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the class of rifamycins. It is highly effective in treating tuberculosis infections. This active compound exhibits bactericidal activity by binding to DNA-dependent RNA polymerase, preventing transcription and replication. Its potency has been demonstrated through various scientific techniques such as the patch-clamp technique on human erythrocytes. The drug undergoes several metabolic transformations, including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, it specifically targets markers expressed in Mycobacterium tuberculosis strains and inhibits cell growth in culture.</p>

<p>Rabbit polyclonal PSMB9 antibody</p>

<p>Rabbit polyclonal 4EBP1 antibody (Ser64)</p>

<p>The MYH9 protein is a versatile and essential component found in human serum. It plays a crucial role in various Life Sciences applications, including Proteins and Antigens research. This protein has shown promising antiviral properties and can be used for ultrasensitive detection of viral infections. Additionally, MYH9 protein interacts with other important molecules such as transferrin and growth factors, making it an excellent tool for studying their functions. Recombinant forms of MYH9 protein are available, which can be used to develop neutralizing monoclonal antibodies against specific targets like influenza hemagglutinin. Furthermore, MYH9 protein can serve as a valuable tool for screening inhibitors or antibodies in drug discovery research due to its low-molecular-weight nature.</p>

<p>Recombinant Human COQ9 protein (His tag)</p>

<p>The PSAT1 antibody is a highly specialized monoclonal antibody used in Life Sciences research. It is designed to specifically target and bind to the PSAT1 protein, which plays a crucial role in cellular metabolism and growth regulation. This antibody can be used in various applications, including Western blotting, immunohistochemistry, and enzyme-linked immunosorbent assays (ELISA).</p>

<p>SLF-100 is an enzymatic solution, which is derived from a consortium of beneficial microorganisms. This product functions by breaking down organic matter and releasing bound nutrients within the soil, thus enhancing nutrient availability and promoting plant health. The action of SLF-100 is mediated primarily by its enzymatic components, which include cellulase, amylase, and protease, among others. These enzymes work synergistically to degrade complex organic compounds, facilitating the release of macro and micronutrients.</p>

<p>The SDHB antibody is a highly specialized monoclonal antibody used in the field of Life Sciences. It is designed to target and neutralize interleukin-6 (IL-6), an important cytokine involved in various biological processes. By inhibiting IL-6, this antibody can effectively block its signaling pathways, preventing the activation of downstream events.</p>

<p>NS3763 is a drug that has been shown to have neuroprotective effects in animal models of epilepsy and stroke. It selectively inhibits the activity of the gamma-aminobutyric acid (GABA) receptor, which is an inhibitory neurotransmitter. NS3763 has also been shown to prevent glutamate-induced neuronal death in mice. This drug also blocks the activity of cation channels that are activated by GABA, resulting in depressed excitatory effects and decreased seizure susceptibility. The mechanism of action for NS3763 is unclear, but it may function as a non-selective cation channel activator or as an excitatory effector. In addition to its neuroprotective properties, NS3763 has been shown to have anxiolytic effects in animal models and may be useful for treating nervous system diseases such as epilepsy and stroke.</p>

<p>Purified Polyclonal STMN2 antibody</p>

<p>ZNF326 antibody was raised in rabbit using the C terminal of ZNF326 as the immunogen</p>

<p>Bis-MAL-Lysine-dPEG®4-dPEG®12-Tris(m-dPEG®24)3 is a peptide containing polyethylene glycol (PEG) as spacer to alter their pharmacokinetic properties and pharmodynamics.</p>

<p>ZNF799 antibody was raised in rabbit using the n terminal of ZNF799 as the immunogen</p>

<p>Albumin antibody was raised in Mouse using Human albumin as the immunogen.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of HSPB2 antibody, catalog no. 70R-3974</p>

<p>Purified Polyclonal GABRA4 antibody</p>

<p>GBP5 antibody was raised in Rabbit using Human GBP5 as the immunogen</p>

<p>LAP3 antibody was raised using the N terminal of LAP3 corresponding to a region with amino acids LNISGPPLKAGKTRTFYGLHQDFPSVVLVGLGKKAAGIDEQENWHEGKEN</p>

<p>26-216 amino acids: MLLPGPSAAD EKKKGPKVTV KVYFDLRIGD EDVGRVIFGL FGKTVPKTVD NFVALATGEK GFGYKNSKFH RVIKDFMIQG GDFTRGDGTG GKSIYGERFP DENFKLKHYG PGWVSMANAG KDTNGSQFFI TTVKTAWLDG KHVVFGKVLE GMEVVRKVES TKTDSRDKPL KDVIIADCGK IEVEKPFAIA KE</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of DPP6 antibody, catalog no. 70R-6835</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of KRT13 antibody, catalog no. 70R-1178</p>

<p>MRPL2 antibody was raised in Rabbit using Human MRPL2 as the immunogen</p>

<p>MRGSHHHHHH GMASMTGGQQ MGRDLYDDDD KDRWGSMPMF IVNTNVPRAS VPDGFLSELT QQLAQATGKP PQYIAVHVVP DQLMAFGGSS EPCALCSLHS IGKIGGAQNR SYSKLLCGLL AERLRISPDR VYINYYDMNA ANVGWNNSTF A</p>

<p>PCGF6 antibody was raised using the middle region of PCGF6 corresponding to a region with amino acids TQPLYNISANEGTGHFKPLEKKFVRVSGEATIGHVEKFLRRKMGLDPACQ</p>

<p>GSTA3 antibody was raised using the middle region of GSTA3 corresponding to a region with amino acids SSLISNFPLLKALKTRISNLPTVKKFLQPGSPRKPPADAKALEEARKIFR</p>

<p>The elF4E antibody is a colloidal polyclonal antibody that has neutralizing properties. It targets the superoxide tyrosine, which is involved in various cellular processes such as chemokine signaling and kinase inhibition. This antibody can be used in assays related to life sciences, specifically in the study of TNF-α. In addition to its polyclonal form, there are also monoclonal antibodies available for specific targeting. The elF4E antibody has been extensively tested and validated using liver microsomes. It is a valuable tool for researchers in the field of life sciences who are studying various cellular processes and pathways.</p>