Biochemicals and Reagents
Subcategories of "Biochemicals and Reagents"
- Biomolecules(98,572 products)
- By Biological Target(100,755 products)
- By Pharmacological Effects(6,938 products)
- Cryopreservatives(21 products)
- Desinfectants and Related Compounds(28 products)
- Hormones(467 products)
- Plant Biology(6,906 products)
- Secondary Metabolites(14,368 products)
Found 130507 products of "Biochemicals and Reagents"
HNF4 alpha antibody
The HNF4 alpha antibody is a highly specialized product used in the field of Life Sciences. It belongs to the category of monoclonal antibodies and is specifically designed to target and neutralize the HNF4 alpha protein. This protein plays a crucial role in various biological processes, including the development and function of cardiomyocytes.Purity:Min. 95%PTDSR antibody
PTDSR antibody was raised in rabbit using the C terminal of PTDSR as the immunogenPurity:Min. 95%Goat anti Human IgA (α chain)
This antibody reacts with heavy chains on human IgA (alpha chain) and.Purity:Min. 95%PGA5 antibody
PGA5 antibody was raised in Mouse using a purified recombinant fragment of human PGA5 expressed in E. coli as the immunogen.MASTL antibody
The MASTL antibody is a highly specialized polyclonal antibody used in the field of Life Sciences. It is designed to target and bind to MASTL (microtubule-associated serine/threonine kinase-like) protein, which plays a crucial role in various cellular processes.HMGB1 antibody
The HMGB1 antibody is a monoclonal antibody that specifically targets the high mobility group box 1 (HMGB1) protein. This protein is a growth factor that plays a crucial role in various biological processes, including inflammation and immune response. The HMGB1 antibody can be used in Life Sciences research to study the function and regulation of HMGB1.
TAFI antibody
TAFI antibody was raised in sheep using human TAFI purified from plasma as the immunogen.
P2RXL1 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of P2RXL1 antibody, catalog no. 70R-5077
Purity:Min. 95%TRIM36 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of TRIM36 antibody, catalog no. 70R-2752Purity:Min. 95%ZNF670 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of ZNF670 antibody, catalog no. 70R-8103Purity:Min. 95%SMYD4 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of SMYD4 antibody, catalog no. 70R-8981Purity:Min. 95%RAVER1 antibody
RAVER1 antibody was raised using the N terminal of RAVER1 corresponding to a region with amino acids VTHRPPLSPKSGAEVEAGDAAERRAPEEELPPLDPEEIRKRLEHTERQFRCKLF Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of CKLF antibody, catalog no. 70R-6407Purity:Min. 95%CDH3 antibody
CDH3 antibody was raised using a synthetic peptide corresponding to a region with amino acids AVSENGASVEDPMNISIIVTDQNDHKPKFTQDTFRGSVLEGVLPGTSVMQ
ANKRD37 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of ANKRD37 antibody, catalog no. 70R-3163Purity:Min. 95%AKAP7 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of AKAP7 antibody, catalog no. 70R-1138Purity:Min. 95%ACBD7 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of ACBD7 antibody, catalog no. 70R-3468Purity:Min. 95%NSMCE2 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of NSMCE2 antibody, catalog no. 70R-3196Purity:Min. 95%TPRXL antibody
TPRXL antibody was raised in rabbit using the C terminal of TPRXL as the immunogenPurity:Min. 95%Factor VIII antibody
Factor VIII antibody was raised in Mouse using a purified recombinant fragment of Factor VIII expressed in E. coli as the immunogen.
TRUB2 antibody
TRUB2 antibody was raised using the middle region of TRUB2 corresponding to a region with amino acids MNKSPMLITGIRCLYFAPPEFLLEVQCMHETQKELRKLVHEIGLELKTTA
C9ORF75 antibody
C9ORF75 antibody was raised using the middle region of C9Orf75 corresponding to a region with amino acids EAMVRCGGVERWGESDTRASPCVHILSSHFQLTPASQNDLSDFRSEPALYAcid Sphingomyelinase antibody
The Acid Sphingomyelinase antibody is a high-quality polyclonal antibody that targets the e-cadherin protein. It is commonly used in Life Sciences research to study the expression and function of e-cadherin, a glycoprotein involved in cell adhesion and signaling. This antibody is highly specific and exhibits excellent colloidal properties, making it ideal for various biochemical assays and experiments. Whether you're studying helicobacter infection or investigating the role of e-cadherin in cancer progression, this reliable antibody will provide accurate results. With its exceptional quality and efficacy, the Acid Sphingomyelinase antibody is an indispensable tool for researchers in the field of Life Sciences.
BLK antibody
BLK antibody was raised in Mouse using a purified recombinant fragment of BLK expressed in E. coli as the immunogen.APC2 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of APC2 antibody, catalog no. 70R-8919Purity:Min. 95%GPD2 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of GPD2 antibody, catalog no. 70R-7263
Purity:Min. 95%c-kit antibody
The c-kit antibody is a highly specialized antibody that targets the c-kit protein. It has been extensively studied in the field of Life Sciences and has shown promising results in various research areas. The c-kit antibody is commonly used in experiments involving imatinib, an important drug used to treat certain types of cancer.
Purity:Min. 95%SOD1 antibody
The SOD1 antibody is a powerful tool in Life Sciences research. It specifically targets the superoxide dismutase 1 (SOD1) protein, which plays a crucial role in regulating oxidative stress and maintaining cell health. This antibody can be used in various applications, including chemokine and endothelial growth factor assays, as well as fibrinogen agglutination assays.IFRD1 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of IFRD1 antibody, catalog no. 70R-1986Purity:Min. 95%ZNF385D antibody
ZNF385D antibody was raised in rabbit using the N terminal of ZNF385D as the immunogen
Purity:Min. 95%Calcitonin antibody
Calcitonin antibody is a specialized product used in the field of Life Sciences. It acts as an immunosuppressant and inhibitor, targeting specific molecules and pathways in the body. This antibody is colloidal in nature and can be used in various applications such as research, diagnostics, and therapeutics.HAVCR1 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of HAVCR1 antibody, catalog no. 70R-7200Purity:Min. 95%
