Biochemicals and Reagents

<p>Rabbit polyclonal SLC37A2 antibody</p>

<p>The HUR antibody is a highly specialized monoclonal antibody that has been developed for use in the field of Life Sciences. This antibody is specifically designed to target and neutralize influenza hemagglutinin, a protein found on the surface of the influenza virus. By binding to this protein, the HUR antibody effectively inhibits viral replication and spread.</p>

<p>Purified Polyclonal Caspase 5 p20 antibody</p>

<p>CALCOCO1 antibody was raised in Rabbit using Human CALCOCO1 as the immunogen</p>

<p>GNB3 antibody was raised in Rabbit using Human GNB3 as the immunogen</p>

<p>Cryptosporidium Monoclonal Antibody (FITC)</p>

<p>OATP2/OATP8 antibody was raised in mouse using synthetic N-terminus (24 aa) of human organic anion transporter OATP2 coupled to KLH as the immunogen.</p>

<p>ZNF785 antibody was raised in rabbit using the C terminal of ZNF785 as the immunogen</p>

<p>The Tn antigen antibody is a high-specificity monoclonal antibody that targets the Tn antigen, a unique carbohydrate structure found on certain molecules in the body. This antibody has been extensively studied and proven to have excellent binding affinity for the Tn antigen.</p>

<p>Prosurfactant protein C antibody was raised in rabbit using recombinant fusion protein containing GST and amino acids.. 1-20 from the n-terminal of the human SP-C proprotein as the immunogen.</p>

<p>Rabbit polyclonal Kinase E2 antibody</p>

<p>The ETS1 antibody is a highly specialized monoclonal antibody that has been developed for use in various research applications. It specifically targets and neutralizes the activated form of ETS1, a transcription factor that plays a critical role in regulating gene expression. This antibody has been extensively tested and validated for its specificity and sensitivity.</p>

<p>Purified recombinant PRKACB protein (His tag)</p>

<p>RNASEN antibody was raised using the middle region of RNASEN corresponding to a region with amino acids AAMDALEKYNFPQMAHQKRFIERKYRQELKEMRWEREHQEREPDETEDIK</p>

<p>Recombinant Human MAPK8 protein with His tag</p>

<p>GHRL antibody was raised in Rabbit using Human GHRL as the immunogen</p>

<p>Mouse monoclonal SLC7A8 antibody</p>

<p>FCER1A antibody was raised using the N terminal of FCER1A corresponding to a region with amino acids NPPWNRIFKGENVTLTCNGNNFFEVSSTKWFHNGSLSEETNSSLNIVNAK</p>

<p>Purified recombinant NDUFA4 protein (His tag)</p>

<p>Rabbit Polyclonal KIF13B antibody</p>

<p>Mouse monoclonal CDKN3 antibody</p>

<p>Rabbit polyclonal MSK1 antibody</p>

<p>SLC27A3 antibody was raised using a synthetic peptide corresponding to a region with amino acids PFSLIRYDVTTGEPIRDPQGHCMATSPGEPGLLVAPVSQQSPFLGYAGGP</p>

<p>The PLK1 antibody is a highly specialized monoclonal antibody that targets the polo-like kinase 1 (PLK1) protein. This antibody has been extensively studied and proven to be effective in various research applications.</p>

<p>Purified Polyclonal Carbonic Anhydrase 2 antibody</p>

<p>Mouse monoclonal PPM1F antibody</p>

<p>Mouse monoclonal AK4 antibody</p>

<p>Mouse monoclonal MGLL antibody</p>

<p>The MHC Class II antibody is a powerful tool in the field of Life Sciences. It is a monoclonal antibody that specifically targets and neutralizes MHC Class II molecules. These molecules play a crucial role in the immune response by presenting antigens to T cells, thereby initiating an immune response. The MHC Class II antibody can be used in various applications such as immunohistochemistry, flow cytometry, and Western blotting. It has been shown to effectively stain actin filaments, growth factors, collagen, glycoproteins, fibrinogen, and other cellular components. Additionally, this antibody has been used to study the role of MHC Class II molecules in various biological processes including antigen presentation and cytokine production. Its high specificity and affinity make it an essential tool for researchers studying immune responses and related diseases.</p>

<p>Rabbit polyclonal TFAP2C antibody</p>

<p>Purified Rabbit polyclonal GPRIN3 antibody</p>

<p>The CD1a antibody is a crucial tool in the field of Life Sciences. It is a monoclonal antibody that specifically targets CD1a, a cell surface protein involved in various biological processes. This antibody can be used for research purposes to study the function and expression of CD1a in different cell types.</p>

<p>Sheep polyclonal Sulphatroxazole antibody</p>

<p>Purified recombinant LMX1B protein (His tag)</p>

<p>Rat monoclonal Rat anti-Mouse IgA antibody (FITC)</p>

<p>Mouse monoclonal NPR3 antibody</p>

<p>Rat monoclonal CIRE antibody (allophycocyanin)</p>

<p>Rabbit Polyclonal MRLC2 antibody (Ser18)</p>

<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the category of rifamycins. It is highly effective in treating tuberculosis infections, thanks to its bactericidal activity. By binding to DNA-dependent RNA polymerase, this drug inhibits bacterial growth by preventing transcription and replication. Its potency has been demonstrated through patch-clamp technique experiments on human erythrocytes. The active form of this drug undergoes various metabolic transformations, including hydrolysis, oxidation, reduction, and conjugation with glucuronic acid. Additionally, it specifically targets markers expressed in Mycobacterium tuberculosis strains and inhibits their cell growth in culture.</p>

<p>ERAL1 antibody was raised using a synthetic peptide corresponding to a region with amino acids KTAVWEEGPGGELVIQQKLLVPKESYVKLLIGPKGHVISQIAQEAGHDLM</p>

<p>Purified Rabbit polyclonal Smad3 antibody (Ser213)</p>

<p>The HIV1 Nef protein is a vital component in the field of Life Sciences. It is a serine protease inhibitor that plays a crucial role in neutralizing the effects of HIV1. This Recombinant Protein &amp; Antigen forms dimers and has been extensively studied for its potential therapeutic applications. Researchers have found that it exhibits inhibitory effects on the replication of HIV1, making it a promising target for drug development.</p>

<p>Sheep polyclonal Flunixin COOH antibody</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of C20ORF100 antibody, catalog no. 70R-7817</p>

<p>Recombinant Human KLF4 protein (His tag)</p>

<p>CYP4B1 antibody was raised using the N terminal of CYP4B1 corresponding to a region with amino acids SWAHQFPYAHPLWFGQFIGFLNIYEPDYAKAVYSRGDPKAPDVYDFFLQW</p>

<p>Armenian Hamster monoclonal CD69 antibody (PE)</p>

<p>LYVE1 antibody was raised in rabbit using recombinant human soluble Lyve-1 as the immunogen.</p>

<p>LDH antibody was raised in goat using full length lactate dehydrogenase protein isolated from rabbit muscle as the immunogen.</p>

<p>Rabbit polyclonal JAK2 antibody (Tyr931)</p>