Biochemicals and Reagents
Subcategories of "Biochemicals and Reagents"
- Biomolecules(98,574 products)
- By Biological Target(100,728 products)
- By Pharmacological Effects(6,938 products)
- Cryopreservatives(21 products)
- Desinfectants and Related Compounds(28 products)
- Hormones(440 products)
- Plant Biology(6,906 products)
- Secondary Metabolites(14,368 products)
Found 130507 products of "Biochemicals and Reagents"
UBE4B antibody
UBE4B antibody was raised using a synthetic peptide corresponding to a region with amino acids SPMFCSVASFGASSLSSLYESSPAPTPSFWSSVPVMGPSLASPSRAASQLRLN1 antibody
RLN1 antibody was raised in rabbit using the middle region of RLN1 as the immunogen
Purity:Min. 95%BAIAP2L2 antibody
The BAIAP2L2 antibody is a highly specific monoclonal antibody used in Life Sciences research. It targets the β-catenin protein, which plays a crucial role in cell growth and development. This antibody can be used to study the interactions between β-catenin and other growth factors, such as alpha-synuclein and epidermal growth factor.FAM135B Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of FAM135B antibody, catalog no. 70R-3897Purity:Min. 95%SP1 antibody
SP1 antibody was raised in rabbit using the C terminal of SP1 as the immunogenPurity:Min. 95%KBTBD10 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of KBTBD10 antibody, catalog no. 20R-1205Purity:Min. 95%ZDHHC17 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of ZDHHC17 antibody, catalog no. 70R-5970
Purity:Min. 95%TWIST1 antibody
The TWIST1 antibody is a highly specialized polyclonal antibody used in the field of Life Sciences. It is commonly employed in various research applications such as polymerase chain reactions, monoclonal antibody assays, and formation assays. This antibody plays a crucial role in studying the interaction between cyclin D1/CDK4 and inhibitor p21, which are key proteins involved in cell cycle regulation. Additionally, the TWIST1 antibody can be utilized in DNA vaccine studies and hybridization experiments to investigate cyclin D2 expression and cyclin-dependent kinase activity. Researchers also employ this antibody to test substances for their potential impact on hepatic steatosis (fatty liver disease). With its high specificity and reliability, the TWIST1 antibody is an essential tool for scientists exploring molecular mechanisms and cellular processes related to cancer, development, and other areas of biomedical research.
Cytokeratin 16 antibody
The Cytokeratin 16 antibody is a powerful tool in the field of life sciences. It is a polyclonal antibody that specifically targets cytokeratin 16, an intermediate filament protein found in various epithelial tissues. This antibody has been extensively studied and proven to be effective in detecting and quantifying cytokeratin 16 expression.ZNFN1A5 antibody
ZNFN1A5 antibody was raised in rabbit using the N terminal of ZNFN1A5 as the immunogenPurity:Min. 95%BSG antibody
The BSG antibody is a highly specialized product in the field of Life Sciences. It is an antiviral monoclonal antibody that specifically targets and neutralizes the activated glycoprotein known as BSG (Basigin). This monoclonal antibody has been extensively studied and proven to have high affinity and specificity for BSG.HSV1 gG antibody
HSV1 gG antibody was raised in mouse using herpes simplex type 1 gG as the immunogen.KIF22 antibody
KIF22 antibody was raised using the C terminal of KIF22 corresponding to a region with amino acids LASQGSQGAPLLSTPKRERMVLMKTVEEKDLEIERLKTKQKELEAKMLAQAquaporin 10 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of AQP10 antibody, catalog no. 70R-7451Purity:Min. 95%TOP2A antibody
TOP2A antibody was raised in rabbit using the C terminal of TOP2A as the immunogenPurity:Min. 95%AIM2 antibody
AIM2 antibody is a cytotoxic monoclonal antibody that targets the AIM2 protein. The AIM2 protein is involved in the regulation of cell growth and proliferation, specifically in the interaction between hyaluronic acid and epidermal growth factor receptors. This antibody can be used in various life science applications, including research, diagnostics, and therapeutic development.CD29 antibody
CD29 antibody was raised in mouse using recombinant human CD29 (34-141aa) purified from E. coli as the immunogen.B4galt5 antibody
B4galt5 antibody was raised in rabbit using the C terminal of B4galt5 as the immunogenPurity:Min. 95%A4GNT antibody
A4GNT antibody was raised using the N terminal of A4GNT corresponding to a region with amino acids LLLVCGFLYQFTLKSSCLFCLPSFKSHQGLEALLSHRRGIVFLETSERME
Purity:Min. 95%GADD45B protein
1-160 amino acids: MTLEELVACD NAAQKMQTVT AAVEELLVAA QRQDRLTVGV YESAKLMNVD PDSVVLCLLA IDEEEEDDIA LQIHFTLIQS FCCDNDINIV RVSGMQRLAQ LLGEPAETQG TTEARDLHCL LVTNPHTDAW KSHGLVEVAS YCEESRGNNQ WVPYISLQERPurity:Min. 95%PRMT2 antibody
PRMT2 antibody was raised using the N terminal of PRMT2 corresponding to a region with amino acids ESQGEEPAECSEAGLLQEGVQPEEFVAIADYAATDETQLSFLRGEKILILCD117 antibody (Azide Free)
CD117 antibody was raised in rat using murine CD117/c-Kit as the immunogen.RXRB antibody
RXRB antibody was raised using the N terminal of RXRB corresponding to a region with amino acids MHCGVASRWRRRRPWLDPAAAAAAAVAGGEQQTPEPEPGEAGRDGMGDSG
ABHD2 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of ABHD2 antibody, catalog no. 70R-2941Purity:Min. 95%OR11H12 antibody
OR11H12 antibody was raised using the N terminal of OR11H12 corresponding to a region with amino acids CPLTLQVTGLMNVSEPNSSFAFVNEFILQGFTCEWTIQIFLFSLFTTTYAPurity:Min. 95%LRRC33 antibody
LRRC33 antibody was raised using the middle region of LRRC33 corresponding to a region with amino acids LHQNCLMTLHIREHEPPGALTELDLSHNQLSELHLAPGLASCLGSLRLFN
Purity:Min. 95%ARGFX antibody
ARGFX antibody was raised in rabbit using the N terminal of ARGFX as the immunogenPurity:Min. 95%ZNF254 antibody
ZNF254 antibody was raised in rabbit using the middle region of ZNF254 as the immunogenPurity:Min. 95%PRSS23 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of PRSS23 antibody, catalog no. 70R-9165Purity:Min. 95%TFF1 antibody
The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is an active compound that belongs to the class of antituberculosis drugs known as rifamycins. It is highly effective in treating tuberculosis infections. This drug exhibits bactericidal activity by inhibiting bacterial growth through binding to DNA-dependent RNA polymerase, preventing transcription and replication. The high frequency of human activity has been demonstrated using a patch-clamp technique on human erythrocytes. 6-Fluoro-3-indoxyl-beta-D-galactopyranoside undergoes various metabolic transformations, including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, it specifically targets markers expressed at high levels in Mycobacterium tuberculosis strains and inhibits cell growth in culture.Gabra5 antibody
Gabra5 antibody was raised in rabbit using the middle region of Gabra5 as the immunogenPurity:Min. 95%HIF1 alpha antibody
The HIF1 alpha antibody is a highly specialized biomolecule used in the field of Life Sciences. It belongs to the class of Polyclonal Antibodies and Monoclonal Antibodies, which are widely recognized for their antigen-binding capabilities. This antibody specifically targets the growth factor known as interleukin-6 (IL-6), an important molecule involved in various biological processes.Purity:Min. 95%Chst2 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of Chst2 antibody, catalog no. 70R-8651Purity:Min. 95%Psmc1 antibody
Psmc1 antibody was raised in rabbit using the C terminal of Psmc1 as the immunogenPurity:Min. 95%
